JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114385

Recombinant Human SKP2 protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human SKP2 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 424 aa range, expressed in Wheat germ, with >80%, suitable for SDS-PAGE, ELISA, WB.

대체 명칭 보기

FBXL1, SKP2, S-phase kinase-associated protein 2, Cyclin-A/CDK2-associated protein p45, F-box protein Skp2, F-box/LRR-repeat protein 1, p45skp2

1 이미지
SDS-PAGE - Recombinant Human SKP2 protein (GST tag N-Terminus) (AB114385)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human SKP2 protein (GST tag N-Terminus) (AB114385)

ab114385 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

주요 정보

Purity

>80%

Glutathione Sepharose

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, ELISA, WB

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL","proteinLength":"Full Length","predictedMolecularWeight":"72.71 kDa","actualMolecularWeight":null,"aminoAcidEnd":424,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q13309","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Affinity purification GST Tag
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

S-phase kinase-associated protein 2 (SKP2) also known as FBL1 or p45 is an E3 ubiquitin ligase that tags proteins for degradation. It weighs around 48 kDa. SKP2 facilitates the transition from the G1 to S phase of the cell cycle by targeting cyclin-dependent kinase inhibitors for proteasomal destruction. Expressed in various tissues including key roles in proliferating cells SKP2 ensures the regulation of cell cycle progression and stability.
Biological function summary

SKP2 is part of the SCF (SKP1-CUL1-F-box) complex which is instrumental in controlling cell cycle and cell division. It regulates the degradation of p27^Kip1 and other cell cycle regulators. By modulating proteolysis SKP2 contributes to the maintenance of cell proliferation and it has essential roles in cellular responses to growth signals. Moreover SKP2 influences processes such as DNA replication through its effect on substrate interaction and ubiquitination.

Pathways

SKP2 functions inside the ubiquitin-proteasome system and impacts the PI3K/AKT signaling pathway. SKP2 advances cell cycle progression by associating with proteins like p27^Kip1 and CDK2 facilitating cell division. It modulates the phosphorylation state of numerous targets influencing signaling processes that control cell growth. This involvement aligns SKP2 with key cellular pathways that maintain cell survival and metabolic balance.

SKP2 plays an important role in cancer and cardiovascular diseases. In various cancers the aberrant expression of SKP2 connects to excessive cell proliferation and tumor growth partially through interactions with oncoproteins like Myc. In cardiovascular conditions SKP2 influences cardiac hypertrophy and might link to proteins such as cyclin-dependent kinase inhibitors. The regulation by SKP2 affects these proteins' stability impacting disease progression and potential therapeutic interventions.

일반 정보

기능

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription (PubMed : 9736735, PubMed : 11931757, PubMed : 12435635, PubMed : 12769844, PubMed : 12840033, PubMed : 15342634, PubMed : 15668399, PubMed : 15949444, PubMed : 16103164, PubMed : 16262255, PubMed : 16581786, PubMed : 16951159, PubMed : 17908926, PubMed : 17962192, PubMed : 22464731, PubMed : 22770219, PubMed : 32267835). Specifically recognizes phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition (By similarity). Degradation of CDKN1B/p27kip also requires CKS1 (By similarity). Recognizes target proteins ORC1, CDT1, RBL2, KMT2A/MLL1, CDK9, RAG2, NBN, FOXO1, UBP43, YTHDF2, and probably MYC, TOB1 and TAL1 (PubMed : 11931757, PubMed : 12435635, PubMed : 12769844, PubMed : 12840033, PubMed : 15342634, PubMed : 15668399, PubMed : 15949444, PubMed : 16103164, PubMed : 16581786, PubMed : 16951159, PubMed : 17908926, PubMed : 17962192, PubMed : 22464731, PubMed : 32267835). Degradation of TAL1 also requires STUB1 (PubMed : 17962192). Recognizes CDKN1A in association with CCNE1 or CCNE2 and CDK2 (PubMed : 9736735, PubMed : 16262255). Promotes ubiquitination and destruction of CDH1 in a CK1-dependent manner, thereby regulating cell migration (PubMed : 22770219). Following phosphorylation in response to DNA damage, mediates 'Lys-63'-linked ubiquitination of NBN, promoting ATM recruitment to DNA damage sites and DNA repair via homologous recombination (PubMed : 22464731).. Through the ubiquitin-mediated proteasomal degradation of hepatitis C virus non-structural protein 5A, has an antiviral activity towards that virus.

Post-translational modifications

Phosphorylated on serine and threonine resudues in response to DNA damage, promoting 'Lys-63'-linked ubiquitination of NBN.. Ubiquitinated by the APC/C complex, leading to its degradation by the proteasome. Deubiquitinated by USP13.. Acetylation at Lys-68 and Lys-71 increases stability through impairment of APC/C-mediated proteolysis and promotes cytoplasmic retention. Deacetylated by SIRT3.

Subcellular localisation

Nucleus

제품 프로토콜

타겟 정보

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription (PubMed : 9736735, PubMed : 11931757, PubMed : 12435635, PubMed : 12769844, PubMed : 12840033, PubMed : 15342634, PubMed : 15668399, PubMed : 15949444, PubMed : 16103164, PubMed : 16262255, PubMed : 16581786, PubMed : 16951159, PubMed : 17908926, PubMed : 17962192, PubMed : 22464731, PubMed : 22770219, PubMed : 32267835). Specifically recognizes phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition (By similarity). Degradation of CDKN1B/p27kip also requires CKS1 (By similarity). Recognizes target proteins ORC1, CDT1, RBL2, KMT2A/MLL1, CDK9, RAG2, NBN, FOXO1, UBP43, YTHDF2, and probably MYC, TOB1 and TAL1 (PubMed : 11931757, PubMed : 12435635, PubMed : 12769844, PubMed : 12840033, PubMed : 15342634, PubMed : 15668399, PubMed : 15949444, PubMed : 16103164, PubMed : 16581786, PubMed : 16951159, PubMed : 17908926, PubMed : 17962192, PubMed : 22464731, PubMed : 32267835). Degradation of TAL1 also requires STUB1 (PubMed : 17962192). Recognizes CDKN1A in association with CCNE1 or CCNE2 and CDK2 (PubMed : 9736735, PubMed : 16262255). Promotes ubiquitination and destruction of CDH1 in a CK1-dependent manner, thereby regulating cell migration (PubMed : 22770219). Following phosphorylation in response to DNA damage, mediates 'Lys-63'-linked ubiquitination of NBN, promoting ATM recruitment to DNA damage sites and DNA repair via homologous recombination (PubMed : 22464731).. Through the ubiquitin-mediated proteasomal degradation of hepatitis C virus non-structural protein 5A, has an antiviral activity towards that virus.
See full target information SKP2

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com