JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276423

Recombinant Human SLAMF7/CS1 protein (Fc Chimera)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human SLAMF7/CS1 protein (Fc Chimera) is a Human Fragment protein, in the 1 to 226 aa range, expressed in HEK 293 cells, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

대체 명칭 보기

CD319, CS1, UNQ576/PRO1138, SLAMF7, SLAM family member 7, CD2 subset 1, CD2-like receptor-activating cytotoxic cells, Membrane protein FOAP-12, Novel Ly9, Protein 19A, CRACC

1 이미지
SDS-PAGE - Recombinant Human SLAMF7/CS1 protein (Fc Chimera) (AB276423)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human SLAMF7/CS1 protein (Fc Chimera) (AB276423)

SDS-PAGE analysis of ab276423.

주요 정보

Purity

>90% SDS-PAGE

Endotoxin 레벨

< 1 EU/µg

발현 시스템

HEK 293 cells

Tags

Fc tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM","proteinLength":"Fragment","predictedMolecularWeight":"49.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":226,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q9NQ25","tags":[{"tag":"Fc","terminus":"C-Terminus"}]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

SLAMF7 also known as CS1 is a glycoprotein with a mass of approximately 70 kDa. This protein localizes on the surface of immune cells mainly on natural killer (NK) cells certain subsets of T cells and mature dendritic cells. It does not express in resting B cells but can be induced upon activation. CS1 plays a role in immune modulation by facilitating cell-to-cell interactions and activating various signaling pathways that enable immune responses.
Biological function summary

SLAMF7/CS1 modulates immune functions by engaging in interactions with other cell surface receptors. It often operates in the context of hematopoietic cells integrating signals that influence cell proliferation differentiation and survival. It does not require an associated adaptor molecule like most of the SLAM family members as it signals through its ability to recruit EAT-2. The CS1 protein modulates pathways related to immune cell activation and control making it an important player in the regulation of immune responses.

Pathways

CS1 participates prominently in immune signaling pathways where it interacts with proteins such as SAP and EAT-2. It is particularly involved in the immunoregulatory interactions contributing to NK cell-mediated cytotoxicity and modulation of T-cell responses. These interactions illustrate CS1's role in the modulation of immune responses positioning it within the broader network of immune signaling pathways important for maintaining immune homeostasis and defense mechanisms.

SLAMF7/CS1 shows key relevance in multiple myeloma and systemic lupus erythematosus (SLE). In multiple myeloma CS1 presents an overexpression and serves as a therapeutic target; its relationship with CD38 another important marker illustrates the potential for targeted therapies. In SLE improper signaling involving CS1 can contribute to the dysregulation of immune responses. Overall the intricate interactions of CS1 with other proteins highlight its significance in disease pathology and therapeutic potential.

일반 정보

기능

Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Isoform 1 mediates NK cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway (PubMed : 11698418). Positively regulates NK cell functions by a mechanism dependent on phosphorylated SH2D1B. Downstream signaling implicates PLCG1, PLCG2 and PI3K (PubMed : 16339536). In addition to heterotypic NK cells-target cells interactions also homotypic interactions between NK cells may contribute to activation. However, in the absence of SH2D1B, inhibits NK cell function. Also acts inhibitory in T-cells (By similarity). May play a role in lymphocyte adhesion (PubMed : 11802771). In LPS-activated monocytes negatively regulates production of pro-inflammatory cytokines (PubMed : 23695528).. Isoform 3 does not mediate any NK cell activation.

제품 프로토콜

타겟 정보

Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Isoform 1 mediates NK cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway (PubMed : 11698418). Positively regulates NK cell functions by a mechanism dependent on phosphorylated SH2D1B. Downstream signaling implicates PLCG1, PLCG2 and PI3K (PubMed : 16339536). In addition to heterotypic NK cells-target cells interactions also homotypic interactions between NK cells may contribute to activation. However, in the absence of SH2D1B, inhibits NK cell function. Also acts inhibitory in T-cells (By similarity). May play a role in lymphocyte adhesion (PubMed : 11802771). In LPS-activated monocytes negatively regulates production of pro-inflammatory cytokines (PubMed : 23695528).. Isoform 3 does not mediate any NK cell activation.
See full target information SLAMF7

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com