JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB113120

Recombinant Human SNRPD3/Sm-D3 protein (His tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(1 출판물)

Recombinant Human SNRPD3/Sm-D3 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 126 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

대체 명칭 보기

Small nuclear ribonucleoprotein Sm D3, Sm-D3, snRNP core protein D3, SNRPD3

1 이미지
SDS-PAGE - Recombinant Human SNRPD3/Sm-D3 protein (His tag N-Terminus) (AB113120)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human SNRPD3/Sm-D3 protein (His tag N-Terminus) (AB113120)

15% SDS-PAGE analysis of ab113120 (3μg)

주요 정보

Purity

>85% SDS-PAGE

ab113120 was purified using conventional chromatography.

발현 시스템

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 40% Glycerol (glycerin, glycerine), 2.92% Sodium chloride, 0.32% Tris HCl, 0.03% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.002% PMSF

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

Previously labelled as SNRPD3.

서열 정보

[{"linker":null,"sequence":"MGSSHHHHHHSSGLVPRGSHMSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR","proteinLength":"Full Length","predictedMolecularWeight":"16 kDa","actualMolecularWeight":null,"aminoAcidEnd":126,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P62318","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 기간
1-2 weeks
적절한 단기 보관 조건
+4°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

SNRPD3 also known as Sm-D3 is a protein that plays an important role in the assembly of small nuclear ribonucleoproteins (snRNPs) essential for pre-mRNA splicing. This protein has a molecular mass of approximately 10 kDa. It functions as a core component of the spliceosomal machinery an essential complex in eukaryotic gene expression. You can find SNRPD3 expressed in various tissues where pre-mRNA splicing activity is required reflecting its fundamental role in cellular processes.
Biological function summary

SNRPD3 participates in snRNP assembly by interacting with other Sm proteins to form a heptameric ring structure around small nuclear RNAs (snRNAs). As part of the major spliceosomal snRNPs SNRPD3 contributes to the modification and catalysis of pre-mRNA splicing. The protein also gets involved in RNA stability and regulation. As a member of the spliceosome complex SNRPD3 helps ensure the fidelity and precision of splicing events important for generating mature mRNA molecules.

Pathways

The actions of SNRPD3 lie within the splicing pathway and have implications in the gene expression pathway. Interaction occurs with other proteins such as SNRPD1 and SNRPD2 which are also part of the snRNP complex facilitating effective spliceosomal function. The U1 snRNP specifically involving SNRPD3 plays a part in the recognition of splice sites initiating the splicing of pre-mRNAs.

Issues with SNRPD3 function or expression might relate to autoimmune diseases such as lupus and some neurodegenerative conditions. Antinuclear antibodies targeting snRNP components including SNRPD3 are common in systemic lupus erythematosus indicating its involvement in the disease's pathology. Furthermore alterations in splicing mechanisms involving SNRPD3 might influence neurodegenerative disorders due to its role in RNA processing and stability potentially relating to other RNA-binding proteins like hnRNPs.

일반 정보

기능

Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome (PubMed : 11991638, PubMed : 18984161, PubMed : 19325628, PubMed : 25555158, PubMed : 26912367, PubMed : 28076346, PubMed : 28502770, PubMed : 28781166, PubMed : 32494006). Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes (PubMed : 11991638, PubMed : 28076346, PubMed : 28502770, PubMed : 28781166). As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs (PubMed : 15146077, PubMed : 33509932). As part of the U7 snRNP it is involved in histone pre-mRNA 3'-end processing (By similarity).

서열 유사성

Belongs to the snRNP core protein family.

Post-translational modifications

Methylated on arginine residues by PRMT5 and PRMT7; probable asymmetric dimethylation which is required for assembly and biogenesis of snRNPs.

제품 프로토콜

타겟 정보

Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome (PubMed : 11991638, PubMed : 18984161, PubMed : 19325628, PubMed : 25555158, PubMed : 26912367, PubMed : 28076346, PubMed : 28502770, PubMed : 28781166, PubMed : 32494006). Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes (PubMed : 11991638, PubMed : 28076346, PubMed : 28502770, PubMed : 28781166). As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs (PubMed : 15146077, PubMed : 33509932). As part of the U7 snRNP it is involved in histone pre-mRNA 3'-end processing (By similarity).
See full target information SNRPD3

제품이 사용된 논문 (1)

Recent publications for all applications. Explore the 전체 목록 and refine your search

Cell reports 30:1935-1950.e8 PubMed32049022

2020

Symmetric Arginine Dimethylation Is Selectively Required for mRNA Splicing and the Initiation of Type I and Type III Interferon Signaling.

Applications

Unspecified application

Species

Unspecified reactive species

Patrick J Metz,Keith A Ching,Tao Xie,Paulina Delgado Cuenca,Sherry Niessen,John H Tatlock,Kristen Jensen-Pergakes,Brion W Murray
제품이 사용된 논문 모두 보기

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com