JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB198119

Recombinant Human TAF1 protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human TAF1 protein (GST tag N-Terminus) is a Human Fragment protein, in the 1519 to 1651 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

대체 명칭 보기

BA2R, CCG1, CCGS, TAF2A, TAF1, Transcription initiation factor TFIID subunit 1, Cell cycle gene 1 protein, TBP-associated factor 250 kDa, Transcription initiation factor TFIID 250 kDa subunit, p250, TAF(II)250, TAFII-250, TAFII250

1 이미지
SDS-PAGE - Recombinant Human TAF1 protein (GST tag N-Terminus) (AB198119)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human TAF1 protein (GST tag N-Terminus) (AB198119)

4-20% SDS-PAGE stained with Coomassie Blue.
Lane 1 : ab198119 (2.7 μg)
Lane 2 : Protein Marker

주요 정보

Purity

>90% SDS-PAGE

발현 시스템

Escherichia coli

Tags

GST tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.02% Potassium chloride

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAE","proteinLength":"Fragment","predictedMolecularWeight":"42.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":1651,"aminoAcidStart":1519,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P21675","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

TAF1 also known as TATA-box binding protein associated factor 1 has a mechanical role as a transcription factor in the initiation process of transcription. This protein forms a part of the larger transcription factor IID (TFIID) complex weighing approximately 200 kDa. TAF1 expresses broadly in tissues where it plays an important role in mediating transcriptional regulation. It is a general transcription factor that serves as a molecular scaffold essential for recruiting the necessary machinery to specific promotor regions of DNA for transcription activation.
Biological function summary

TAF1 interacts extensively with other TFIID components to control the formation of the pre-initiation complex on core promoters. This protein is integral to the regulation of gene expression by modulating transcriptional activity in cells. TAF1 acts as a histone acetyltransferase and a kinase modifying other proteins' functions and structural capabilities in the transcription process. Its enzymatic activities make it essential for the phosphorylation and acetylation of histones directly impacting the accessibility of chromatin for transcription.

Pathways

TAF1 functions prominently in the RNA polymerase II transcription initiation pathway. Its interactions with TATA-binding protein and other TAFs facilitate the robust expression of genes essential for various cellular functions. TAF1 establishes connections with proteins like TBP acting within the canonical pathway that guides precise transcription initiation. Additionally TAF1 partakes in the p53 signaling pathway where it interacts with several p53 regulators influencing cell cycle regulation and apoptosis.

TAF1 mutations are linked to X-linked dystonia-parkinsonism and certain neurodegenerative disorders. Aberrations in TAF1 function impact transcriptional regulation leading to dysregulation in neuronal gene expression. Furthermore TAF1 associations with Huntington's disease have been documented highlighting its role in neuronal survival and stress response. In these diseases altered pathways implicate TAF1 with other proteins such as Huntingtin underlining its importance in maintaining neuronal health and function.

일반 정보

기능

The TFIID basal transcription factor complex plays a major role in the initiation of RNA polymerase II (Pol II)-dependent transcription (PubMed : 33795473). TFIID recognizes and binds promoters with or without a TATA box via its subunit TBP, a TATA-box-binding protein, and promotes assembly of the pre-initiation complex (PIC) (PubMed : 33795473). The TFIID complex consists of TBP and TBP-associated factors (TAFs), including TAF1, TAF2, TAF3, TAF4, TAF5, TAF6, TAF7, TAF8, TAF9, TAF10, TAF11, TAF12 and TAF13 (PubMed : 33795473). TAF1 is the largest component and core scaffold of the TFIID complex, involved in nucleating complex assembly (PubMed : 25412659, PubMed : 27007846, PubMed : 33795473). TAF1 forms a promoter DNA binding subcomplex of TFIID, together with TAF7 and TAF2 (PubMed : 33795473). Contains novel N- and C-terminal Ser/Thr kinase domains which can autophosphorylate or transphosphorylate other transcription factors (PubMed : 25412659, PubMed : 8625415). Phosphorylates TP53 on 'Thr-55' which leads to MDM2-mediated degradation of TP53 (PubMed : 25412659). Phosphorylates GTF2A1 and GTF2F1 on Ser residues (PubMed : 25412659). Possesses DNA-binding activity (PubMed : 25412659). Essential for progression of the G1 phase of the cell cycle (PubMed : 11278496, PubMed : 15053879, PubMed : 2038334, PubMed : 8450888, PubMed : 8625415, PubMed : 9660973, PubMed : 9858607). Exhibits histone acetyltransferase activity towards histones H3 and H4 (PubMed : 15870300).

서열 유사성

Belongs to the TAF1 family.

Post-translational modifications

Phosphorylated by casein kinase II in vitro.

제품 프로토콜

타겟 정보

The TFIID basal transcription factor complex plays a major role in the initiation of RNA polymerase II (Pol II)-dependent transcription (PubMed : 33795473). TFIID recognizes and binds promoters with or without a TATA box via its subunit TBP, a TATA-box-binding protein, and promotes assembly of the pre-initiation complex (PIC) (PubMed : 33795473). The TFIID complex consists of TBP and TBP-associated factors (TAFs), including TAF1, TAF2, TAF3, TAF4, TAF5, TAF6, TAF7, TAF8, TAF9, TAF10, TAF11, TAF12 and TAF13 (PubMed : 33795473). TAF1 is the largest component and core scaffold of the TFIID complex, involved in nucleating complex assembly (PubMed : 25412659, PubMed : 27007846, PubMed : 33795473). TAF1 forms a promoter DNA binding subcomplex of TFIID, together with TAF7 and TAF2 (PubMed : 33795473). Contains novel N- and C-terminal Ser/Thr kinase domains which can autophosphorylate or transphosphorylate other transcription factors (PubMed : 25412659, PubMed : 8625415). Phosphorylates TP53 on 'Thr-55' which leads to MDM2-mediated degradation of TP53 (PubMed : 25412659). Phosphorylates GTF2A1 and GTF2F1 on Ser residues (PubMed : 25412659). Possesses DNA-binding activity (PubMed : 25412659). Essential for progression of the G1 phase of the cell cycle (PubMed : 11278496, PubMed : 15053879, PubMed : 2038334, PubMed : 8450888, PubMed : 8625415, PubMed : 9660973, PubMed : 9858607). Exhibits histone acetyltransferase activity towards histones H3 and H4 (PubMed : 15870300).
See full target information TAF1

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com