JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB171687

Recombinant Human TAF10 protein (His tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human TAF10 protein (His tag N-Terminus) is a Human Fragment protein, in the 84 to 218 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE.

대체 명칭 보기

TAF2A, TAF2H, TAFII30, TAF10, Transcription initiation factor TFIID subunit 10, STAF28, Transcription initiation factor TFIID 30 kDa subunit, TAF(II)30, TAFII-30

1 이미지
SDS-PAGE - Recombinant Human TAF10 protein (His tag N-Terminus) (AB171687)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human TAF10 protein (His tag N-Terminus) (AB171687)

15% SDS-PAGE analysis of ab171687 (3µg).

주요 정보

Purity

>85% SDS-PAGE

ab171687 is purified using conventional chromatography techniques.

발현 시스템

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MGSSHHHHHHSSGLVPRGSHMGSGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT","proteinLength":"Fragment","predictedMolecularWeight":"16.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":218,"aminoAcidStart":84,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q12962","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 기간
1-2 weeks
적절한 단기 보관 조건
+4°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

TAF10 also known as TATA-box binding protein associated factor 10 is a component of the transcription machinery. It has a molecular weight of approximately 21 kDa. This protein is involved in assembling the general transcription factors necessary for the transcription of class II genes. TAF10 is broadly expressed in many tissues particularly in cells that undergo frequent transcriptional activity such as those in the liver and kidney.
Biological function summary

TAF10 acts as an integral part of the transcription factor IID (TFIID) complex which is essential for RNA polymerase II-driven transcription initiation. TAF10 contributes to the recognition and binding of promoter DNA sequences facilitating transcription initiation. It also serves a regulatory role in mediating interactions between the TFIID complex and other transcription factors enhancing transcriptional control and efficiency.

Pathways

TAF10 plays an important role in the regulation of gene expression and RNA polymerase II transcription pathways. It interacts with various components of the transcription initiation complex to initiate and regulate transcription. TAF10 associates with other TAFs and TBP (TATA-binding protein) in the TFIID complex together forming a scaffold for the correct assembly of RNA polymerase II.

TAF10 has been associated with neurodegenerative disorders and certain cancers. Mutations or dysregulation of TAF10 can lead to disruptions in gene expression contributing to the pathogenesis of these conditions. In the case of cancer TAF10 intersects with tumor suppressor proteins such as p53 influencing cell cycle regulation and tumor growth. These interactions highlight TAF10's importance in maintaining cellular homeostasis and its potential role in disease mechanisms.

일반 정보

기능

The TFIID basal transcription factor complex plays a major role in the initiation of RNA polymerase II (Pol II)-dependent transcription (PubMed : 33795473). TFIID recognizes and binds promoters with or without a TATA box via its subunit TBP, a TATA-box-binding protein, and promotes assembly of the pre-initiation complex (PIC) (PubMed : 33795473). The TFIID complex consists of TBP and TBP-associated factors (TAFs), including TAF1, TAF2, TAF3, TAF4, TAF5, TAF6, TAF7, TAF8, TAF9, TAF10, TAF11, TAF12 and TAF13 (PubMed : 33795473). TAF10 is also component of the PCAF histone acetylase complex, the TATA-binding protein-free TAF complex (TFTC) and the STAGA transcription coactivator-HAT complex (PubMed : 10373431, PubMed : 11564863, PubMed : 12601814, PubMed : 18206972, PubMed : 9885574). May regulate cyclin E expression (By similarity).

서열 유사성

Belongs to the TAF10 family.

Post-translational modifications

Monomethylated at Lys-189 by SETD7, leading to increased affinity for RNA polymerase II.. Lysine deamination at Lys-189 to form allysine is mediated by LOXL2. Allysine formation by LOXL2 results in release of TAF10 from promoters, leading to inhibition of TFIID-dependent transcription.

Subcellular localisation

Nucleus

제품 프로토콜

타겟 정보

The TFIID basal transcription factor complex plays a major role in the initiation of RNA polymerase II (Pol II)-dependent transcription (PubMed : 33795473). TFIID recognizes and binds promoters with or without a TATA box via its subunit TBP, a TATA-box-binding protein, and promotes assembly of the pre-initiation complex (PIC) (PubMed : 33795473). The TFIID complex consists of TBP and TBP-associated factors (TAFs), including TAF1, TAF2, TAF3, TAF4, TAF5, TAF6, TAF7, TAF8, TAF9, TAF10, TAF11, TAF12 and TAF13 (PubMed : 33795473). TAF10 is also component of the PCAF histone acetylase complex, the TATA-binding protein-free TAF complex (TFTC) and the STAGA transcription coactivator-HAT complex (PubMed : 10373431, PubMed : 11564863, PubMed : 12601814, PubMed : 18206972, PubMed : 9885574). May regulate cyclin E expression (By similarity).
See full target information TAF10

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com