JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152743

Recombinant Human Thyroglobulin protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human Thyroglobulin protein (GST tag N-Terminus) is a Human Fragment protein, in the 2659 to 2768 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

대체 명칭 보기

Thyroglobulin, Tg, TG

1 이미지
SDS-PAGE - Recombinant Human Thyroglobulin protein (GST tag N-Terminus) (AB152743)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Thyroglobulin protein (GST tag N-Terminus) (AB152743)

12.5% SDS-PAGE analysis of ab152743 stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, WB, ELISA

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"FSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWSKYISSLKTSADGAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK","proteinLength":"Fragment","predictedMolecularWeight":"37.84 kDa","actualMolecularWeight":null,"aminoAcidEnd":2768,"aminoAcidStart":2659,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P01266","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Thyroglobulin often abbreviated as Tg is a glycoprotein with a molecular mass of approximately 660 kDa. It is expressed primarily in the thyroid gland particularly within the follicular cells. This protein serves as a precursor for thyroid hormones such as thyroxine (T4) and triiodothyronine (T3). High thyroglobulin levels in the bloodstream can indicate altered thyroid function and clinicians frequently measure these levels for diagnostic purposes. Researchers have developed specific anti-thyroglobulin antibodies to facilitate the study and measurement of this protein in various contexts.
Biological function summary

Thyroglobulin plays a critical role in the synthesis and storage of thyroid hormones. It acts as a scaffold for iodination and hormone synthesis within the colloid of thyroid follicles. Thyroglobulin is not part of a protein complex; rather it undergoes iodination to form hormone precursors that later convert into active hormones. Anti-thyroglobulin antibodies can be used in research or diagnostic labs to detect the presence or concentration of thyroglobulin in serum samples. These antibodies help in understanding the nuances of thyroid hormone biosynthesis and in monitoring thyroid activity.

Pathways

Thyroglobulin is deeply involved in the thyroid hormone synthesis pathway a fundamental part of the endocrine system's operations. This process connects closely with the iodine metabolism pathway as iodine plays an essential role in hormone production. Thyroglobulin interacts indirectly with proteins like thyroid peroxidase which catalyzes iodination of thyroglobulin. The synthesis and release of thyroid hormones proceed through a carefully orchestrated sequence affecting many physiological processes including metabolism growth and development.

Thyroglobulin has associations with conditions such as thyroid cancer and autoimmune thyroid diseases. For instance elevated serum thyroglobulin can serve as a tumor marker in differentiated thyroid cancer. Anti-thyroglobulin antibodies are often present in autoimmune thyroid diseases like Hashimoto's thyroiditis where the body's immune system mistakenly targets thyroid proteins. Thyroid peroxidase antibodies are also common in these disorders indicating a shared autoimmune response against thyroid-specific antigens. Understanding these relationships aids in the diagnosis and management of thyroid-related conditions.

일반 정보

기능

Acts as a substrate for the production of iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3) (PubMed : 17532758, PubMed : 32025030). The synthesis of T3 and T4 involves iodination of selected tyrosine residues of TG/thyroglobulin followed by their oxidative coupling in the thyroid follicle lumen (PubMed : 32025030). Following TG re-internalization and lysosomal-mediated proteolysis, T3 and T4 are released from the polypeptide backbone leading to their secretion into the bloodstream (PubMed : 32025030). One dimer produces 7 thyroid hormone molecules (PubMed : 32025030).

서열 유사성

Belongs to the type-B carboxylesterase/lipase family.

Post-translational modifications

Iodinated on tyrosine residues by TPO (PubMed:2760035, PubMed:32025030). There are 4 pairs of iodinated tyrosines used for coupling: acceptor Tyr-24 is coupled to donor Tyr-149 or Tyr-234, acceptor Tyr-2573 is coupled to donor Tyr-2540, acceptor Tyr-2766 in monomer 1 is coupled to donor Tyr-2766 in monomer 2 and acceptor Tyr-1310 in monomer 1 is coupled to donor Tyr-108 in monomer 2 (PubMed:32025030).. Sulfated tyrosines are desulfated during iodination.. Undergoes sequential proteolysis by cathepsins to release thyroxine (T4) and triiodothyronine (T3) hormones. In the thyroid follicle lumen, cross-linked TG (storage form) is solubilized by limited proteolysis mediated by cathepsins CTSB and/or CTSL. Partially cleaved TG is further processed by CTSK/cathepsin K and/or CTSL resulting in the release of T4. Following endocytosis, further processing occurs leading to the release of T3 and more T4 hormones.

제품 프로토콜

타겟 정보

Acts as a substrate for the production of iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3) (PubMed : 17532758, PubMed : 32025030). The synthesis of T3 and T4 involves iodination of selected tyrosine residues of TG/thyroglobulin followed by their oxidative coupling in the thyroid follicle lumen (PubMed : 32025030). Following TG re-internalization and lysosomal-mediated proteolysis, T3 and T4 are released from the polypeptide backbone leading to their secretion into the bloodstream (PubMed : 32025030). One dimer produces 7 thyroid hormone molecules (PubMed : 32025030).
See full target information Thyroglobulin

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com