JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB153341

Recombinant Human TLR7 protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human TLR7 protein (GST tag N-Terminus) is a Human Fragment protein, in the 27 to 126 aa range, expressed in Wheat germ, with >80%, suitable for ELISA, WB.

대체 명칭 보기

UNQ248/PRO285, TLR7, Toll-like receptor 7

1 이미지
SDS-PAGE - Recombinant Human TLR7 protein (GST tag N-Terminus) (AB153341)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human TLR7 protein (GST tag N-Terminus) (AB153341)

ab153341 on a 12.5% SDS-PAGE stained with Coomassie Blue.

주요 정보

Purity

>80%

Glutathione Sepharose

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"ARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIPGGIPTNTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKPRSFSGL","proteinLength":"Fragment","predictedMolecularWeight":"37 kDa","actualMolecularWeight":null,"aminoAcidEnd":126,"aminoAcidStart":27,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9NYK1","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Affinity purification GST Tag
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

TLR7 also known as Toll-like receptor 7 plays a mechanical role in the immune system by recognizing single-stranded RNA molecules. This receptor with a mass of approximately 120 kDa is a member of the Toll-like receptor family. TLR7 mainly expresses in immune cells like plasmacytoid dendritic cells and B cells. Its location on the endosomal surface allows it to detect viral RNA and trigger downstream signaling cascades.
Biological function summary

TLR7 induces an immune response by activating pathways that lead to the production of cytokines and type I interferons. It does not function alone but interacts within a complex involving other adaptors such as MyD88. This interaction initiates a signaling cascade that is essential for mounting an acute response to viral infections and boosting adaptive immunity.

Pathways

Single-stranded RNA detection through TLR7 activates the MyD88-dependent pathway which is important for innate immune responses. This pathway includes key components such as NF-κB and IRF7 leading to inflammatory cytokine production. TLR7 links with these proteins working together to activate the host defense mechanism against viral infections.

TLR7 plays a significant role in autoimmunity and viral infections. Aberrant activation of TLR7 has connections with systemic lupus erythematosus (SLE) where it may contribute to pathogenesis by promoting autoantibody production. Additionally TLR7 influences the immune response in chronic infections like hepatitis C where it operates with proteins like MyD88 and contributes to disease progression and severity.

일반 정보

기능

Endosomal receptor that plays a key role in innate and adaptive immunity (PubMed : 14976261, PubMed : 32433612). Controls host immune response against pathogens through recognition of uridine-containing single strand RNAs (ssRNAs) of viral origin or guanosine analogs (PubMed : 12738885, PubMed : 27742543, PubMed : 31608988, PubMed : 32706371, PubMed : 35477763). Upon binding to agonists, undergoes dimerization that brings TIR domains from the two molecules into direct contact, leading to the recruitment of TIR-containing downstream adapter MYD88 through homotypic interaction (PubMed : 27742543). In turn, the Myddosome signaling complex is formed involving IRAK4, IRAK1, TRAF6, TRAF3 leading to activation of downstream transcription factors NF-kappa-B and IRF7 to induce pro-inflammatory cytokines and interferons, respectively (PubMed : 27742543, PubMed : 32706371). In plasmacytoid dendritic cells, RNASET2 endonuclease cooperates with PLD3 or PLD4 5'->3' exonucleases to process RNA and release 2',3'-cyclic guanosine monophosphate (2',3'-cGMP) and cytidine-rich RNA fragments that occupy TLR7 ligand-binding pockets and trigger a signaling-competent state.

서열 유사성

Belongs to the Toll-like receptor family.

Subcellular localisation

Endosome

제품 프로토콜

타겟 정보

Endosomal receptor that plays a key role in innate and adaptive immunity (PubMed : 14976261, PubMed : 32433612). Controls host immune response against pathogens through recognition of uridine-containing single strand RNAs (ssRNAs) of viral origin or guanosine analogs (PubMed : 12738885, PubMed : 27742543, PubMed : 31608988, PubMed : 32706371, PubMed : 35477763). Upon binding to agonists, undergoes dimerization that brings TIR domains from the two molecules into direct contact, leading to the recruitment of TIR-containing downstream adapter MYD88 through homotypic interaction (PubMed : 27742543). In turn, the Myddosome signaling complex is formed involving IRAK4, IRAK1, TRAF6, TRAF3 leading to activation of downstream transcription factors NF-kappa-B and IRF7 to induce pro-inflammatory cytokines and interferons, respectively (PubMed : 27742543, PubMed : 32706371). In plasmacytoid dendritic cells, RNASET2 endonuclease cooperates with PLD3 or PLD4 5'->3' exonucleases to process RNA and release 2',3'-cyclic guanosine monophosphate (2',3'-cGMP) and cytidine-rich RNA fragments that occupy TLR7 ligand-binding pockets and trigger a signaling-competent state.
See full target information TLR7

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com