JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276285

Recombinant Human TREM1 protein (Fc Chimera His Tag)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Human TREM1 protein (Fc Chimera His Tag) is a Human Fragment protein, in the 1 to 200 aa range, expressed in HEK 293 cells, with >97%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

대체 명칭 보기

CD354, Triggering receptor expressed on myeloid cells 1, TREM-1, Triggering receptor expressed on monocytes 1, TREM1

1 이미지
SDS-PAGE - Recombinant Human TREM1 protein (Fc Chimera His Tag) (AB276285)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human TREM1 protein (Fc Chimera His Tag) (AB276285)

SDS-PAGE analysis of ab276285

주요 정보

Purity

>97% SDS-PAGE

Endotoxin 레벨

< 1 EU/µg

발현 시스템

HEK 293 cells

Tags

Fc tag C-Terminus His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MRKTRLWGLLWMLFVSELRAATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIR","proteinLength":"Fragment","predictedMolecularWeight":"48.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":200,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q9NP99","tags":[{"tag":"Fc","terminus":"C-Terminus"},{"tag":"His","terminus":"C-Terminus"}]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Triggering receptor expressed on myeloid cells 1 (TREM1) is a transmembrane receptor involved in amplifying inflammatory responses. TREM1 is known alternatively as CD354. This protein has a molecular mass of approximately 30 kDa and is expressed on the surface of neutrophils monocytes and macrophages. The receptor participates in innate immune responses and acts as an amplifier for inflammatory signals. It is often found in tissues that are engaged in inflammatory processes including lungs and intestines.
Biological function summary

TREM1 significantly enhances the immune response by activating myeloid cells. It does not form a standalone unit; instead it works with the adapter protein DNAX-activating protein of 12 kDa (DAP12) which pairs with TREM1 to transduce signals that promote cytokine and chemokine release. Through this interaction the receptor plays a role in the defense against bacterial infection boosting the body's immune response during pathogen assault. This function positions TREM1 as an important player in the regulation of acute inflammation.

Pathways

TREM1 engages significantly in the Toll-like receptor (TLR) signaling pathway and NF-kB pathway. In these pathways TREM1 interacts with various proteins that include TLRs and DAP12 intensifying inflammatory responses. The integration of TREM1 within these pathways suggests that it acts as an important modulator of inflammation capable of enhancing TLR-mediated signals for a stronger immune response.

TREM1 connections extend to sepsis and inflammatory bowel disease (IBD). In the context of sepsis TREM1 expression correlates with increased inflammation and poor prognosis where it interacts with proteins involved in inflammatory pathways such as TNF-α. Concerning IBD TREM1's role in promoting inflammation links it to the pathogenesis of this disease where it could influence the severity and progression of IBD-related inflammation. Given these relationships therapeutic strategies targeting TREM1 could hold potential in modulating these conditions.

일반 정보

기능

Isoform 1. Cell surface receptor that plays important roles in innate and adaptive immunity by amplifying inflammatory responses (PubMed : 10799849, PubMed : 21393102). Upon activation by various ligands such as PGLYRP1, HMGB1 or HSP70, multimerizes and forms a complex with transmembrane adapter TYROBP/DAP12 (PubMed : 17568691, PubMed : 25595774, PubMed : 29568119). In turn, initiates a SYK-mediated cascade of tyrosine phosphorylation, activating multiple downstream mediators such as BTK, MAPK1, MAPK3 or phospholipase C-gamma (PubMed : 14656437, PubMed : 21659545). This cascade promotes the neutrophil- and macrophage-mediated release of pro-inflammatory cytokines and/or chemokines, as well as their migration and thereby amplifies inflammatory responses that are triggered by bacterial and fungal infections (PubMed : 17098818, PubMed : 17568691). By also promoting the amplification of inflammatory signals that are initially triggered by Toll-like receptor (TLR) and NOD-like receptor engagement, plays a major role in the pathophysiology of acute and chronic inflammatory diseases of different etiologies including septic shock and atherosclerosis (PubMed : 11323674, PubMed : 21393102).. Isoform 2. Acts as a decoy receptor, counterbalancing TREM1 pro-inflammatory activity through the neutralization of its ligand.

Post-translational modifications

Glycosylated.

제품 프로토콜

타겟 정보

Isoform 1. Cell surface receptor that plays important roles in innate and adaptive immunity by amplifying inflammatory responses (PubMed : 10799849, PubMed : 21393102). Upon activation by various ligands such as PGLYRP1, HMGB1 or HSP70, multimerizes and forms a complex with transmembrane adapter TYROBP/DAP12 (PubMed : 17568691, PubMed : 25595774, PubMed : 29568119). In turn, initiates a SYK-mediated cascade of tyrosine phosphorylation, activating multiple downstream mediators such as BTK, MAPK1, MAPK3 or phospholipase C-gamma (PubMed : 14656437, PubMed : 21659545). This cascade promotes the neutrophil- and macrophage-mediated release of pro-inflammatory cytokines and/or chemokines, as well as their migration and thereby amplifies inflammatory responses that are triggered by bacterial and fungal infections (PubMed : 17098818, PubMed : 17568691). By also promoting the amplification of inflammatory signals that are initially triggered by Toll-like receptor (TLR) and NOD-like receptor engagement, plays a major role in the pathophysiology of acute and chronic inflammatory diseases of different etiologies including septic shock and atherosclerosis (PubMed : 11323674, PubMed : 21393102).. Isoform 2. Acts as a decoy receptor, counterbalancing TREM1 pro-inflammatory activity through the neutralization of its ligand.
See full target information TREM1

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com