JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152793

Recombinant Human VDAC2 protein (GST tag N-Terminus)

Be the first to review this product! 리뷰 제출

|

(1 출판물)

Recombinant Human VDAC2 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 294 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

대체 명칭 보기

Non-selective voltage-gated ion channel VDAC2, VDAC-2, hVDAC2, Outer mitochondrial membrane protein porin 2, VDAC2

1 이미지
SDS-PAGE - Recombinant Human VDAC2 protein (GST tag N-Terminus) (AB152793)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human VDAC2 protein (GST tag N-Terminus) (AB152793)

12.5% SDS-PAGE showing ab152793 stained with Coomassie Blue.

주요 정보

발현 시스템

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, ELISA, WB

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

보관 버퍼

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA","proteinLength":"Full Length","predictedMolecularWeight":"57.86 kDa","actualMolecularWeight":null,"aminoAcidEnd":294,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P45880","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
Purification 테크닉
Proprietary technique
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Voltage-dependent anion channel 2 (VDAC2) also known as porin 31HL or P2 mechanically functions as a channel facilitating the transport of anions and metabolites across the outer mitochondrial membrane. This channel approximately 32 kDa in size is most prominent in the mitochondria but can also be observed in other cellular locations. It is involved in regulating both the entry and exit of small ions and molecules which is essential for mitochondrial function and energy production.
Biological function summary

VDAC2 plays significant roles beyond mere ion transport. It interacts with proteins involved in apoptosis such as Bcl-2 family proteins. Although not part of a larger complex its influence on the structure and permeability of the outer mitochondrial membrane impacts several cellular processes. The regulation of apoptosis by VDAC2 is key for cellular homeostasis and response to stress signals highlighting its role in maintaining normal cellular functions.

Pathways

Several cellular processes include VDAC2's role in apoptosis and energy metabolism. VDAC2 interacts with the intrinsic pathway of apoptosis in close association with proteins like Bax and Bak where it influences the release of cytochrome c from mitochondria. Additionally VDAC2 has a role in ATP transport and metabolic flux integral to the bioenergetics pathways by working with adenine nucleotide translocase (ANT) as part of the exchange of ATP and ADP.

Mutations or dysregulation of VDAC2 connect to cancer and neurodegenerative diseases. Its interaction with the Bcl-2 family proteins implicates it in apoptosis resistance observed in various cancers. Likewise VDAC2 dysfunction has links to neurodegenerative diseases through its impact on mitochondrial health as these conditions often display an imbalance in apoptotic pathways and energy metabolism.

일반 정보

기능

Non-selective voltage-gated ion channel that mediates the transport of anions and cations through the mitochondrion outer membrane and plasma membrane (PubMed : 8420959). The channel adopts an open conformation at zero mV and a closed conformation at both positive and negative potentials (PubMed : 8420959). There are two populations of channels; the main that functions in a lower open-state conductance with lower ion selectivity, that switch, in a voltage-dependent manner, from the open to a low-conducting 'closed' state and the other that has a normal ion selectivity in the typical high conductance, 'open' state (PubMed : 8420959). Binds various lipids, including the sphingolipid ceramide, the phospholipid phosphatidylcholine, and the sterols cholesterol and oxysterol (PubMed : 31015432). Binding of ceramide promotes the mitochondrial outer membrane permeabilization (MOMP) apoptotic pathway (PubMed : 31015432). Associates with the translocase of the outer mitochondrial membrane (TOM) complex and PINK1 kinase at depolarized mitochondria, this interaction stabilizes PINK1 at the outer mitochondrial membrane and triggers downstream mitophagy by the recruitment of the E3 ubiquitin ligase PRKN (PubMed : 40080546).. Catalyzes the scrambling of phospholipids across the outer mitochondrial membrane; the mechanism is unrelated to channel activity and is capable of translocating both anionic and zwitterionic phospholipids.

서열 유사성

Belongs to the eukaryotic mitochondrial porin family.

Post-translational modifications

Ubiquitinated by PRKN during mitophagy, leading to its degradation and enhancement of mitophagy. Deubiquitinated by USP30.

제품 프로토콜

타겟 정보

Non-selective voltage-gated ion channel that mediates the transport of anions and cations through the mitochondrion outer membrane and plasma membrane (PubMed : 8420959). The channel adopts an open conformation at zero mV and a closed conformation at both positive and negative potentials (PubMed : 8420959). There are two populations of channels; the main that functions in a lower open-state conductance with lower ion selectivity, that switch, in a voltage-dependent manner, from the open to a low-conducting 'closed' state and the other that has a normal ion selectivity in the typical high conductance, 'open' state (PubMed : 8420959). Binds various lipids, including the sphingolipid ceramide, the phospholipid phosphatidylcholine, and the sterols cholesterol and oxysterol (PubMed : 31015432). Binding of ceramide promotes the mitochondrial outer membrane permeabilization (MOMP) apoptotic pathway (PubMed : 31015432). Associates with the translocase of the outer mitochondrial membrane (TOM) complex and PINK1 kinase at depolarized mitochondria, this interaction stabilizes PINK1 at the outer mitochondrial membrane and triggers downstream mitophagy by the recruitment of the E3 ubiquitin ligase PRKN (PubMed : 40080546).. Catalyzes the scrambling of phospholipids across the outer mitochondrial membrane; the mechanism is unrelated to channel activity and is capable of translocating both anionic and zwitterionic phospholipids.
See full target information Voltage-dependent anion-selective channel protein 2

제품이 사용된 논문 (1)

Recent publications for all applications. Explore the 전체 목록 and refine your search

Biochemical and biophysical research communication 505:1203-1210 PubMed30327144

2018

Sulindac sulfone inhibits the mTORC1 pathway in colon cancer cells by directly targeting voltage-dependent anion channel 1 and 2.

Applications

Unspecified application

Species

Unspecified reactive species

Yuichi Aono,Mano Horinaka,Yosuke Iizumi,Motoki Watanabe,Tomoyuki Taniguchi,Shusuke Yasuda,Toshiyuki Sakai
제품이 사용된 논문 모두 보기

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com