JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB61872

Recombinant human VEGF 121B protein

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant human VEGF 121B protein is a Human Full Length protein, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, FuncS.
3 이미지
Functional Studies - Recombinant human VEGF 121B protein (AB61872)
  • FuncS

Unknown

Functional Studies - Recombinant human VEGF 121B protein (AB61872)

ab61872 used in Functional Studies.

Functional Studies - Recombinant human VEGF 121B protein (AB61872)
  • FuncS

Unknown

Functional Studies - Recombinant human VEGF 121B protein (AB61872)

Functional analysis of ab61872

SDS-PAGE - Recombinant human VEGF 121B protein (AB61872)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant human VEGF 121B protein (AB61872)

SDS PAGE analysis of ab61872 under non-reducing (-) and reducing (+) conditions. Stained with Coomassie Blue.

주요 정보

Purity

>95% SDS-PAGE

Purity greater than 95% as determined by:Analysis by RP-HPLC.Reducing and non-reducing SDS-PAGE.

발현 시스템

Escherichia coli

Tags

Tag free

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Biological Activity: The biological activity is determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 0.2-0.4 ng/ml.

Accession

P15692-9

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute at 100 µg/mL in water

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

Aliquot and freeze at -20°C. It is recommended to add a carrier protein (0.1% HSA or BSA) for long term storage.

서열 정보

[{"linker":null,"sequence":"APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENCDKPRR","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P15692","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
True

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

VEGF 121B also known as Vascular Endothelial Growth Factor 121B is an isoform of the VEGF family. Mechanically it functions as a signal protein that stimulates vasculogenesis and angiogenesis. VEGF 121B is a splice variant that lacks exon 6 and 7 and has a mass of approximately 14 kDa. This protein is expressed in a variety of tissues but it is reported mainly in endothelial cells where it promotes the growth of blood vessels.
Biological function summary

Vascular Endothelial Growth Factor 121B plays an important role in the formation of new blood vessels. It functions as part of the larger VEGF protein family complex which includes other members such as VEGF165 and VEGF189. The binding of VEGF 121B to its receptors on endothelial cells activates signaling pathways that regulate vascular development and permeability. Its role extends to facilitating tissue repair and regeneration by enhancing the supply of nutrients and oxygen through blood vessel growth.

Pathways

VEGF 121B actively participates in the angiogenesis and vascular endothelial growth factor receptor (VEGFR) signaling pathways. These pathways involve interactions with proteins such as VEGFR1 and VEGFR2 which mediate its effects on endothelial cells. VEGF 121B binds to these receptors and triggers downstream signaling cascades ultimately promoting cell proliferation migration and formation of vascular networks.

Altered expression or dysfunctional signaling of VEGF 121B relates to cancer and age-related macular degeneration (AMD). In cancer overexpression of VEGF 121B can lead to increased tumor vascularization enabling tumor growth and metastasis. In AMD its imbalance could contribute to abnormal blood vessel growth in the retina. The dysregulation of VEGF 121B in these conditions often associates with other proteins in the VEGF family such as VEGF-A which together influence the disease progression and response to treatment.

일반 정보

기능

N-VEGF. Participates in the induction of key genes involved in the response to hypoxia and in the induction of angiogenesis such as HIF1A (PubMed : 35455969). Involved in protecting cells from hypoxia-mediated cell death (By similarity).. VEGFA. Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth (PubMed : 34530889). Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Binds to the NRP1/neuropilin-1 receptor. Binding to NRP1 initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity). Also binds the DEAR/FBXW7-AS1 receptor (PubMed : 17446437).. Isoform VEGF165B. Binds to the KDR receptor but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth.

서열 유사성

Belongs to the PDGF/VEGF growth factor family.

Post-translational modifications

Vascular endothelial growth factor A, long form. Produced by use of an alternative upstream CUG codon and post-translationally processed into the N-terminal N-VEGF form and the C-terminal secreted VEGFA form.

제품 프로토콜

타겟 정보

N-VEGF. Participates in the induction of key genes involved in the response to hypoxia and in the induction of angiogenesis such as HIF1A (PubMed : 35455969). Involved in protecting cells from hypoxia-mediated cell death (By similarity).. VEGFA. Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth (PubMed : 34530889). Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Binds to the NRP1/neuropilin-1 receptor. Binding to NRP1 initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity). Also binds the DEAR/FBXW7-AS1 receptor (PubMed : 17446437).. Isoform VEGF165B. Binds to the KDR receptor but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth.
See full target information VEGFA

대체 명칭 보기

VEGF, VEGFA, L-VEGF, Vascular permeability factor, VPF

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com