JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB235617

Recombinant Mouse AMH protein

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Mouse AMH protein is a Mouse Fragment protein, in the 450 to 552 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

대체 명칭 보기

Anti-Muellerian hormone, AMH, Muellerian-inhibiting factor, Muellerian-inhibiting substance, MIS, Amh

3 이미지
Mass Spectrometry - Recombinant Mouse AMH protein (AB235617)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Mouse AMH protein (AB235617)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab235617 indicates that this peptide derived from E.coli-expressed Mus musculus (Mouse) Amh.

Mass Spectrometry - Recombinant Mouse AMH protein (AB235617)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Mouse AMH protein (AB235617)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab235617 indicates that this peptide derived from E.coli-expressed Mus musculus (Mouse) Amh.

SDS-PAGE - Recombinant Mouse AMH protein (AB235617)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse AMH protein (AB235617)

ab235617 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

주요 정보

Purity

>90% SDS-PAGE

발현 시스템

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Mouse

보관 버퍼

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC","proteinLength":"Fragment","predictedMolecularWeight":"11.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":552,"aminoAcidStart":450,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P27106","tags":[]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
보관 정보
Avoid freeze / thaw cycle
False

일반 정보

기능

The anti-Muellerian hormone (AMH) plays an important role in several reproductive functions (PubMed : 11606457, PubMed : 11861535, PubMed : 1782869, PubMed : 9435237). Anti-Muellerian hormone binds and activates AMHR2, its specific type-II receptor, that heterodimerizes with type-I receptors (ACVR1 and BMPR1A) to regulate target gene expression through downstream SMAD protein signal transduction (By similarity). Produced and secreted by Sertoli cells of the male fetus, anti-Muellerian hormone induces Muellerian duct regression during male fetal sexual differentiation (PubMed : 1782869, PubMed : 9435237). In female, it is produced by granulosa cells of the preantral and small antral follicles and acts as a negative regulator of the primordial to primary follicle transition and decreases FSH sensitivity of growing follicles (PubMed : 11606457, PubMed : 11861535). Also plays a role in Leydig cell differentiation and function (PubMed : 1782869, PubMed : 9435237).. Plays an important role in several reproductive functions, including Muellerian duct regression during male fetal sexua,l differentiation and in the adult plays a role in Leydig cell differentiation and function (PubMed : 1782869, PubMed : 9435237). In female acts as a negative regulator of the primordial to primary follicle transition and decreases FSH sensitivity of growing follicles (PubMed : 11606457, PubMed : 11861535). Binds to its sole type II receptor, AMHR2 that recruits type I receptors ACVR1 and BMPR1A which subsequently activates the Smad pathway (By similarity).

서열 유사성

Belongs to the TGF-beta family.

Post-translational modifications

The preproprotein is proteolytically processed to generate the AMH prodomain and the anti-Muellerian hormone (By similarity). Both homodimerize covalently, and homodimers associate to form a non-covalent heterotetrameric complex (By similarity).

제품 프로토콜

타겟 정보

The anti-Muellerian hormone (AMH) plays an important role in several reproductive functions (PubMed : 11606457, PubMed : 11861535, PubMed : 1782869, PubMed : 9435237). Anti-Muellerian hormone binds and activates AMHR2, its specific type-II receptor, that heterodimerizes with type-I receptors (ACVR1 and BMPR1A) to regulate target gene expression through downstream SMAD protein signal transduction (By similarity). Produced and secreted by Sertoli cells of the male fetus, anti-Muellerian hormone induces Muellerian duct regression during male fetal sexual differentiation (PubMed : 1782869, PubMed : 9435237). In female, it is produced by granulosa cells of the preantral and small antral follicles and acts as a negative regulator of the primordial to primary follicle transition and decreases FSH sensitivity of growing follicles (PubMed : 11606457, PubMed : 11861535). Also plays a role in Leydig cell differentiation and function (PubMed : 1782869, PubMed : 9435237).. Plays an important role in several reproductive functions, including Muellerian duct regression during male fetal sexua,l differentiation and in the adult plays a role in Leydig cell differentiation and function (PubMed : 1782869, PubMed : 9435237). In female acts as a negative regulator of the primordial to primary follicle transition and decreases FSH sensitivity of growing follicles (PubMed : 11606457, PubMed : 11861535). Binds to its sole type II receptor, AMHR2 that recruits type I receptors ACVR1 and BMPR1A which subsequently activates the Smad pathway (By similarity).
See full target information Amh

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com