JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271644

Recombinant Mouse CD80 protein (Biotin) (Fc tag C-Terminus + Avi tag C-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Mouse CD80 protein (Biotin) (Fc tag C-Terminus + Avi tag C-Terminus) is a Mouse Fragment protein, in the 20 to 211 aa range, expressed in HEK 293 cells, with >90%, suitable for SDS-PAGE.

대체 명칭 보기

CD80, B7, Cd80, T-lymphocyte activation antigen CD80, Activation B7-1 antigen

1 이미지
SDS-PAGE - Recombinant Mouse CD80 protein (Biotin) (Fc tag C-Terminus + Avi tag C-Terminus) (AB271644)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse CD80 protein (Biotin) (Fc tag C-Terminus + Avi tag C-Terminus) (AB271644)

SDS-PAGE analysis of ab271644.

주요 정보

Purity

>90% SDS-PAGE

발현 시스템

HEK 293 cells

Tags

Fc tag C-Terminus Avi tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Conjugation

Biotin

Excitation/Emission
Accession

Animal free

No

Carrier free

No

Species

Mouse

보관 버퍼

pH: 7.4 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.13% Sodium phosphate, 0.02% Potassium chloride

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"FQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTN","proteinLength":"Fragment","predictedMolecularWeight":"52 kDa","actualMolecularWeight":null,"aminoAcidEnd":211,"aminoAcidStart":20,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q00609","tags":[{"tag":"Fc","terminus":"C-Terminus"},{"tag":"Avi","terminus":"C-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Dry Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

CD80 also known as B7-1 is a cell surface protein with a molecular weight of approximately 60 kDa. It is expressed on antigen-presenting cells such as dendritic cells macrophages and B cells. The CD80 protein plays a mechanical role in immune response modulation by providing necessary signals for T cell activation and survival. CD80 interacts with receptors CD28 and CTLA-4 on T cells serving as a costimulatory molecule important for productive immune responses.
Biological function summary

CD80 plays a significant role in the immune system's ability to distinguish between self and non-self. It belongs to the B7 family and participates in the formation of immunological synapses between T cells and antigen-presenting cells. This interaction is essential for triggering T cell proliferation and cytokine production forming a part of the adaptive immune response. CD80's expression increases in response to pathogen recognition enhancing the immune system's efficiency.

Pathways

CD80 is integral to the regulation of T cell-mediated immune responses. It is involved in the CD28 co-stimulatory pathway which is vital for T cell activation and function. In this pathway CD80 interacts with proteins like CD28 and CTLA-4 to modulate immune activation and regulate immune tolerance. The proper function of CD80 within this pathway ensures a balanced immune reaction preventing autoimmunity while allowing effective defense against pathogens.

CD80 plays a role in autoimmune conditions and transplantation rejection. Its overexpression or dysregulation can contribute to diseases such as rheumatoid arthritis where it modifies T cell response and inflammation. Additionally CD80 is implicated in organ transplantation influencing graft rejection outcomes due to its role in modulating immune activation. Understanding CD80 interactions with CTLA-4 and CD28 offers insight into these conditions providing potential targets for therapeutic intervention.

일반 정보

기능

Costimulatory molecule that belongs to the immunoglobulin superfamily that plays an important role in T-lymphocyte activation. Acts as the primary auxiliary signal augmenting the MHC/TCR signal in naive T-cells together with the CD28 receptor which is constitutively expressed on the cell surface of T-cells (PubMed : 16339518). In turn, activates different signaling pathways such as NF-kappa-B or MAPK leading to the production of different cytokines. In addition, CD28/CD80 costimulatory signal stimulates glucose metabolism and ATP synthesis of T-cells by activating the PI3K/Akt signaling pathway. Acts also as a regulator of PDL1/PDCD1 interactions to limit excess engagement of PDL1 and its inhibitory role in immune responses. Expressed on B-cells, plays a critical role in regulating interactions between B-cells and T-cells in both early and late germinal center responses, which are crucial for the generation of effective humoral immune responses (PubMed : 22450810).

제품 프로토콜

타겟 정보

Costimulatory molecule that belongs to the immunoglobulin superfamily that plays an important role in T-lymphocyte activation. Acts as the primary auxiliary signal augmenting the MHC/TCR signal in naive T-cells together with the CD28 receptor which is constitutively expressed on the cell surface of T-cells (PubMed : 16339518). In turn, activates different signaling pathways such as NF-kappa-B or MAPK leading to the production of different cytokines. In addition, CD28/CD80 costimulatory signal stimulates glucose metabolism and ATP synthesis of T-cells by activating the PI3K/Akt signaling pathway. Acts also as a regulator of PDL1/PDCD1 interactions to limit excess engagement of PDL1 and its inhibitory role in immune responses. Expressed on B-cells, plays a critical role in regulating interactions between B-cells and T-cells in both early and late germinal center responses, which are crucial for the generation of effective humoral immune responses (PubMed : 22450810).
See full target information Cd80

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com