JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB240868

Recombinant mouse CX3CL1 protein (Active)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant mouse CX3CL1 protein (Active) is a Mouse Fragment protein, in the 25 to 100 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

대체 명칭 보기

Cx3c, Fkn, Scyd1, Cx3cl1, Fractalkine, FK, ABCD-3, C-X3-C motif chemokine 1, CX3C membrane-anchored chemokine, Neurotactin, Small-inducible cytokine D1

1 이미지
SDS-PAGE - Recombinant mouse CX3CL1 protein (Active) (AB240868)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant mouse CX3CL1 protein (Active) (AB240868)

SDS-PAGE - Recombinant Mouse CX3CL1 protein (Active) (ab240868)

주요 정보

Purity

>95% SDS-PAGE

Endotoxin 레벨

< 1 EU/µg

발현 시스템

Escherichia coli

Tags

Tag free

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human peripheral blood lymphocytes (PBL) is less than 0.5 μg/ml, corresponding to a specific activity of >2000 IU/mg.

Accession

Animal free

No

Carrier free

Yes

Species

Mouse

Reconstitution

Reconstitute in water or 0.1% BSA aqueous buffer

보관 버퍼

Constituents: PBS

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"QHLGMTKCEIMCGKMTSRIPVALLIRYQLNQESCGKRAIVLETTQHRRFCADPKEKWVQDAMKHLDHQAAALTKNG","proteinLength":"Fragment","predictedMolecularWeight":"8.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":100,"aminoAcidStart":25,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O35188","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
보관 정보
Avoid freeze / thaw cycle
True

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

CX3CL1 also known as fractalkine is a chemokine protein characterized mechanically by its dual function as both a chemoattractant and adhesion molecule. It exhibits a unique membrane-bound structure and can exist in a soluble form after proteolytic cleavage. The mass of CX3CL1 is approximately 42-45 kDa. This protein is highly expressed in endothelial cells neurons and tissues with substantial vascularization. Considerable interest surrounds the potential of CX3CL1 assessment in various studies often involving applications like fractalkine ELISA or assays on mouse models.
Biological function summary

CX3CL1 is involved in the immune system and nervous system functions influencing leukocyte adhesion and migration. It is not known to be part of a large multiprotein complex but directly interacts with its fractalkine receptor CX3CR1 on the surface of immune cells. This interaction regulates communication between neurons and microglia which highlights its role in neuroinflammation. CX3CL1's expression and function suggest a significant influence over inflammatory responses and homeostatic balance within these systems.

Pathways

CX3CL1 plays a role in the MAPK and PI3K-Akt pathways vital for cell survival proliferation and migration. Within these pathways CX3CL1 influences and interacts with several proteins thereby modulating inflammatory responses and cellular migration. These pathways are essential for immune system regulation where CX3CL1 acts as a mediator in signal transduction processes that connect immune responses to cellular activities such as proliferation and survival.

CX3CL1 has associations with neurodegenerative disorders like Alzheimer's disease and inflammatory diseases such as rheumatoid arthritis. Alterations in CX3CL1 expression or its fractalkine receptor function can influence disease progression by affecting how immune cells communicate and migrate to inflamed or damaged tissues. CX3CR1 the receptor for CX3CL1 represents an important link in these connections driving research efforts to explore therapies targeting these interactions to alleviate disease symptoms.

일반 정보

기능

Chemokine that acts as a ligand for both CX3CR1 and integrins ITGAV : ITGB3 and ITGA4 : ITGB1 (PubMed : 10187784, PubMed : 18971423). The CX3CR1-CX3CL1 signaling exerts distinct functions in different tissue compartments, such as immune response, inflammation, cell adhesion and chemotaxis (PubMed : 10187784, PubMed : 10382755, PubMed : 18971423, PubMed : 9177350). Regulates leukocyte adhesion and migration processes at the endothelium (PubMed : 10382755, PubMed : 9177350). Can activate integrins in both a CX3CR1-dependent and CX3CR1-independent manner (By similarity). In the presence of CX3CR1, activates integrins by binding to the classical ligand-binding site (site 1) in integrins (By similarity). In the absence of CX3CR1, binds to a second site (site 2) in integrins which is distinct from site 1 and enhances the binding of other integrin ligands to site 1 (By similarity).. Processed fractalkine. The soluble form is chemotactic for T-cells and monocytes, but not for neutrophils.. Fractalkine. The membrane-bound form promotes adhesion of those leukocytes to endothelial cells.

서열 유사성

Belongs to the intercrine delta family.

Post-translational modifications

A soluble short 80 kDa form may be released by proteolytic cleavage from the long membrane-anchored form.

제품 프로토콜

타겟 정보

Chemokine that acts as a ligand for both CX3CR1 and integrins ITGAV : ITGB3 and ITGA4 : ITGB1 (PubMed : 10187784, PubMed : 18971423). The CX3CR1-CX3CL1 signaling exerts distinct functions in different tissue compartments, such as immune response, inflammation, cell adhesion and chemotaxis (PubMed : 10187784, PubMed : 10382755, PubMed : 18971423, PubMed : 9177350). Regulates leukocyte adhesion and migration processes at the endothelium (PubMed : 10382755, PubMed : 9177350). Can activate integrins in both a CX3CR1-dependent and CX3CR1-independent manner (By similarity). In the presence of CX3CR1, activates integrins by binding to the classical ligand-binding site (site 1) in integrins (By similarity). In the absence of CX3CR1, binds to a second site (site 2) in integrins which is distinct from site 1 and enhances the binding of other integrin ligands to site 1 (By similarity).. Processed fractalkine. The soluble form is chemotactic for T-cells and monocytes, but not for neutrophils.. Fractalkine. The membrane-bound form promotes adhesion of those leukocytes to endothelial cells.
See full target information Cx3cl1

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com