JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB269239

Recombinant Mouse EBI3 protein

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Mouse EBI3 protein is a Mouse Fragment protein, in the 23 to 228 aa range, expressed in Escherichia coli, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

대체 명칭 보기

Il27b, Ebi3, Interleukin-27 subunit beta, IL-27 subunit beta, IL-27B, Epstein-Barr virus-induced gene 3 protein homolog

1 이미지
SDS-PAGE - Recombinant Mouse EBI3 protein (AB269239)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Mouse EBI3 protein (AB269239)

SDS-PAGE analysis of ab269239 at 1ug/lane under (-) non-reducing and (+) reducing conditions. 4-20% Tris glycine gel. Stained with coomassie blue.

주요 정보

Purity

>90% SDS-PAGE

nan

Endotoxin 레벨

< 1 EU/µg

발현 시스템

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute at 0.1 mg/mL in 20 mM HCl

보관 버퍼

Constituents: 0.1% Trifluoroacetic acid

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKP","proteinLength":"Fragment","predictedMolecularWeight":"25 kDa","actualMolecularWeight":null,"aminoAcidEnd":228,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O35228","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C.
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

EBI3 also known as Epstein-Barr virus induced 3 is a cytokine receptor protein with a molecular mass of approximately 34 kDa. This protein plays an important role in the immune system and is widely expressed in various tissues including spleen thymus and peripheral blood leukocytes. EBI3 is often found in cells involved in immune response such as macrophages and dendritic cells. It acts through the formation of heterodimers partnering with other proteins to exert its influence.
Biological function summary

EBI3 serves a function as a component of the cytokine complex. It pairs with other interleukin proteins forming essential heterodimers like IL-27 in which it combines with the cytokine p28. This complex is involved in modulating the immune response including the suppression and activation of T-cells. Through its binding actions EBI3 influences the regulation of immune responses aiding in controlling inflammation and maintaining immune system balance.

Pathways

EBI3 plays a critical role within the IL-27 signaling pathway. These pathways include the JAK/STAT signaling which is pivotal for mediating the immune response and influencing cell proliferation differentiation and apoptosis. EBI3 as part of the IL-27 complex interacts significantly with cytokines like IL-6 influencing the signal transduction pathways that are essential in immune cell communication and function.

EBI3 has associations with autoimmune diseases such as multiple sclerosis due to its role in regulating immune responses. Aberrant expression or function of EBI3 can contribute to the pathogenesis of chronic inflammatory diseases. It also holds potential links to cancer particularly in the modulation and development of tumor-induced immune evasion. In these disease contexts related proteins like p28 within the IL-27 complex interact with EBI3 affecting disease outcomes through their cooperative roles in immune modulation.

일반 정보

기능

Associates with IL27 to form the IL-27 interleukin, a heterodimeric cytokine which functions in innate immunity. IL-27 has pro- and anti-inflammatory properties, that can regulate T-helper cell development, suppress T-cell proliferation, stimulate cytotoxic T-cell activity, induce isotype switching in B-cells, and that has diverse effects on innate immune cells. Among its target cells are CD4 T-helper cells which can differentiate in type 1 effector cells (TH1), type 2 effector cells (TH2) and IL17 producing helper T-cells (TH17). It drives rapid clonal expansion of naive but not memory CD4 T-cells. It also strongly synergizes with IL-12 to trigger interferon-gamma/IFN-gamma production of naive CD4 T-cells, binds to the cytokine receptor WSX-1/TCCR. Another important role of IL-27 is its antitumor activity as well as its antiangiogenic activity with activation of production of antiangiogenic chemokines.

서열 유사성

Belongs to the type I cytokine receptor family. Type 3 subfamily.

제품 프로토콜

타겟 정보

Associates with IL27 to form the IL-27 interleukin, a heterodimeric cytokine which functions in innate immunity. IL-27 has pro- and anti-inflammatory properties, that can regulate T-helper cell development, suppress T-cell proliferation, stimulate cytotoxic T-cell activity, induce isotype switching in B-cells, and that has diverse effects on innate immune cells. Among its target cells are CD4 T-helper cells which can differentiate in type 1 effector cells (TH1), type 2 effector cells (TH2) and IL17 producing helper T-cells (TH17). It drives rapid clonal expansion of naive but not memory CD4 T-cells. It also strongly synergizes with IL-12 to trigger interferon-gamma/IFN-gamma production of naive CD4 T-cells, binds to the cytokine receptor WSX-1/TCCR. Another important role of IL-27 is its antitumor activity as well as its antiangiogenic activity with activation of production of antiangiogenic chemokines.
See full target information Ebi3

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com