JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276876

Recombinant Mouse FZD10 protein (His tag)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Mouse FZD10 protein (His tag) is a Mouse Fragment protein, in the 1 to 162 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

대체 명칭 보기

CD350, Fz10, Fzd10, Frizzled-10, Fz-10

1 이미지
SDS-PAGE - Recombinant Mouse FZD10 protein (His tag) (AB276876)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse FZD10 protein (His tag) (AB276876)

SDS-PAGE analysis of ab276876

주요 정보

Purity

>95% SDS-PAGE

Endotoxin 레벨

< 1 EU/µg

발현 시스템

HEK 293 cells

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Mouse

보관 버퍼

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MQHPGPRLWLVLQVMIGSCTAISSMDLERPGDGKCQPVEIPMCKDIGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFKFRWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPSRG","proteinLength":"Fragment","predictedMolecularWeight":"17.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":162,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q8BKG4","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Frizzled-10 (FZD10) also known as CD350 is a receptor in the frizzled family of proteins. It acts as a receptor for Wnt signaling proteins typically involved in communications between cells. The receptor belongs to the larger group of G-protein-coupled receptors and contains a seven-transmembrane domain structure. Its molecular mass is about 64 kDa. FZD10 is prominently expressed in various tissues including the brain and certain regions of the gastrointestinal tract with higher expression often seen in fetal tissues compared to adult tissues.
Biological function summary

FZD10 plays a significant role in the Wnt signaling pathway that affects cell development differentiation and proliferation. It usually forms part of a receptor complex that includes other proteins like LRP5/6 and Dishevelled. The interaction of FZD10 with Wnt ligands activates downstream signaling cascades important for embryonic development and maintaining stem cell states. Its involvement in these processes underlines its role in regulating key cellular dynamics.

Pathways

FZD10 is central to both the canonical Wnt/β-catenin pathway and non-canonical Wnt pathways. These pathways orchestrate critical cellular functions such as gene expression cytoskeletal arrangement and cellular movement. FZD10 collaborates closely with other frizzled receptors and Wnt proteins like Wnt3a to modulate these pathways. By regulating the stabilization and localization of β-catenin FZD10 influences various downstream target genes essential for cellular activities.

FZD10 shows association with certain cancers particularly synovial sarcoma and colon cancer. Misregulated expression of FZD10 contributes to oncogenic processes by abnormally activating Wnt signaling pathways which in turn affects cellular proliferation and survival. Additionally its association with Wnt signaling proteins such as β-catenin in these disease states emphasizes its impact on tumorigenesis and progression. Understanding FZD10's role offers potential therapeutic targets for interventions in cancers where this pathway is implicated.

일반 정보

기능

Receptor for Wnt proteins (PubMed : 15923619). Functions in the canonical Wnt/beta-catenin signaling pathway (PubMed : 15923619). The canonical Wnt/beta-catenin signaling pathway leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues (Probable).

서열 유사성

Belongs to the G-protein coupled receptor Fz/Smo family.

Post-translational modifications

Ubiquitinated by ZNRF3, leading to its degradation by the proteasome.

제품 프로토콜

타겟 정보

Receptor for Wnt proteins (PubMed : 15923619). Functions in the canonical Wnt/beta-catenin signaling pathway (PubMed : 15923619). The canonical Wnt/beta-catenin signaling pathway leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues (Probable).
See full target information Fzd10

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com