JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB109674

Recombinant mouse IL-17AF protein

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant mouse IL-17AF protein is a Mouse Fragment protein, expressed in Escherichia coli, with >98%, < 0.1 EU/µg endotoxin level, suitable for SDS-PAGE, HPLC, FuncS.

대체 명칭 보기

Ctla8, Il17, Il17a, Interleukin-17A, IL-17, IL-17A, Cytotoxic T-lymphocyte-associated antigen 8, CTLA-8, Interleukin-17F, IL-17F, Il17f

1 이미지
Western blot - Recombinant mouse IL-17AF protein (AB109674)
  • WB

Unknown

Western blot - Recombinant mouse IL-17AF protein (AB109674)

ab109674 used in Western Blot. Figure : 1 ug in each lane (-) non-reducing conditions and (+) reducing conditions in a 4-20% Tris-Glycine gel stained with Coomassie Blue. Mouse IL-17AF is a heterodimer with a predicted total MW of 30.7 kDa.

All lanes:

Western blot - Recombinant mouse IL-17AF protein (ab109674)

false

주요 정보

Purity

>98% SDS-PAGE

Purity Greater than 98% determined by reducing and non-reducing SDS-PAGE.

Endotoxin 레벨

< 0.1 EU/µg

발현 시스템

Escherichia coli

Tags

Tag free

Applications

HPLC, SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

The activity is determined by the dose-dependent induction of IL-6 production in cultured mouse NIH 3T3 fibroblasts, is typically 75-325 ng/mL.

Accession

Animal free

No

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute at 0.1 mg/mL in water

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

Recombinant mouse IL-17AF is a non-glycosylated, disulfide-linked heterodimer. It contains one IL-17A subunit and one IL-17F subunit, with a total of 271 amino acids and an molecular weight of 30.7 kDa.

서열 정보

[{"linker":null,"sequence":"MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREP","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q7TNI7","tags":[]},{"linker":null,"sequence":"MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q62386","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
보관 정보
Avoid freeze / thaw cycle|For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA)
True

일반 정보

기능

Effector cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity (PubMed : 18025225, PubMed : 19144317, PubMed : 26431948). Signals via IL17RA-IL17RC heterodimeric receptor complex, triggering homotypic interaction of IL17RA and IL17RC chains with TRAF3IP2 adapter. This leads to downstream TRAF6-mediated activation of NF-kappa-B and MAPkinase pathways ultimately resulting in transcriptional activation of cytokines, chemokines, antimicrobial peptides and matrix metalloproteinases, with potential strong immune inflammation (PubMed : 16200068, PubMed : 17911633, PubMed : 19144317, PubMed : 26431948). Plays an important role in connecting T cell-mediated adaptive immunity and acute inflammatory response to destroy extracellular bacteria and fungi. As a signature effector cytokine of T-helper 17 cells (Th17), primarily induces neutrophil activation and recruitment at infection and inflammatory sites (PubMed : 18025225). In airway epithelium, mediates neutrophil chemotaxis via induction of CXCL1 and CXCL5 chemokines (PubMed : 18025225, PubMed : 27923703). In secondary lymphoid organs, contributes to germinal center formation by regulating the chemotactic response of B cells to CXCL12 and CXCL13, enhancing retention of B cells within the germinal centers, B cell somatic hypermutation rate and selection toward plasma cells (PubMed : 18157131). Effector cytokine of a subset of gamma-delta T cells that functions as part of an inflammatory circuit downstream IL1B, TLR2 and IL23A-IL12B to promote neutrophil recruitment for efficient bacterial clearance (PubMed : 17372004, PubMed : 20364087, PubMed : 28709803). Effector cytokine of innate immune cells including invariant natural killer cell (iNKT) and group 3 innate lymphoid cells that mediate initial neutrophilic inflammation (PubMed : 17470641, PubMed : 23255360). Involved in the maintenance of the integrity of epithelial barriers during homeostasis and pathogen infection. Upon acute injury, has a direct role in epithelial barrier formation by regulating OCLN localization and tight junction biogenesis (PubMed : 26431948). As part of the mucosal immune response induced by commensal bacteria, enhances host's ability to resist pathogenic bacterial and fungal infections by promoting neutrophil recruitment and antimicrobial peptides release (PubMed : 28709803). In synergy with IL17F, mediates the production of antimicrobial beta-defensins DEFB1, DEFB103A, and DEFB104A by mucosal epithelial cells, limiting the entry of microbes through the epithelial barriers (PubMed : 19144317). Involved in antiviral host defense through various mechanisms (PubMed : 21946434, PubMed : 26735852, PubMed : 27795421). Enhances immunity against West Nile virus by promoting T cell cytotoxicity (PubMed : 27795421). May play a beneficial role in influenza A virus (H5N1) infection by enhancing B cell recruitment and immune response in the lung (PubMed : 21946434). Contributes to influenza A virus (H1N1) clearance by driving the differentiation of B-1a B cells, providing for production of virus-specific IgM antibodies at first line of host defense (PubMed : 26735852).

서열 유사성

Belongs to the IL-17 family.

제품 프로토콜

타겟 정보

Effector cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity (PubMed : 18025225, PubMed : 19144317, PubMed : 26431948). Signals via IL17RA-IL17RC heterodimeric receptor complex, triggering homotypic interaction of IL17RA and IL17RC chains with TRAF3IP2 adapter. This leads to downstream TRAF6-mediated activation of NF-kappa-B and MAPkinase pathways ultimately resulting in transcriptional activation of cytokines, chemokines, antimicrobial peptides and matrix metalloproteinases, with potential strong immune inflammation (PubMed : 16200068, PubMed : 17911633, PubMed : 19144317, PubMed : 26431948). Plays an important role in connecting T cell-mediated adaptive immunity and acute inflammatory response to destroy extracellular bacteria and fungi. As a signature effector cytokine of T-helper 17 cells (Th17), primarily induces neutrophil activation and recruitment at infection and inflammatory sites (PubMed : 18025225). In airway epithelium, mediates neutrophil chemotaxis via induction of CXCL1 and CXCL5 chemokines (PubMed : 18025225, PubMed : 27923703). In secondary lymphoid organs, contributes to germinal center formation by regulating the chemotactic response of B cells to CXCL12 and CXCL13, enhancing retention of B cells within the germinal centers, B cell somatic hypermutation rate and selection toward plasma cells (PubMed : 18157131). Effector cytokine of a subset of gamma-delta T cells that functions as part of an inflammatory circuit downstream IL1B, TLR2 and IL23A-IL12B to promote neutrophil recruitment for efficient bacterial clearance (PubMed : 17372004, PubMed : 20364087, PubMed : 28709803). Effector cytokine of innate immune cells including invariant natural killer cell (iNKT) and group 3 innate lymphoid cells that mediate initial neutrophilic inflammation (PubMed : 17470641, PubMed : 23255360). Involved in the maintenance of the integrity of epithelial barriers during homeostasis and pathogen infection. Upon acute injury, has a direct role in epithelial barrier formation by regulating OCLN localization and tight junction biogenesis (PubMed : 26431948). As part of the mucosal immune response induced by commensal bacteria, enhances host's ability to resist pathogenic bacterial and fungal infections by promoting neutrophil recruitment and antimicrobial peptides release (PubMed : 28709803). In synergy with IL17F, mediates the production of antimicrobial beta-defensins DEFB1, DEFB103A, and DEFB104A by mucosal epithelial cells, limiting the entry of microbes through the epithelial barriers (PubMed : 19144317). Involved in antiviral host defense through various mechanisms (PubMed : 21946434, PubMed : 26735852, PubMed : 27795421). Enhances immunity against West Nile virus by promoting T cell cytotoxicity (PubMed : 27795421). May play a beneficial role in influenza A virus (H5N1) infection by enhancing B cell recruitment and immune response in the lung (PubMed : 21946434). Contributes to influenza A virus (H1N1) clearance by driving the differentiation of B-1a B cells, providing for production of virus-specific IgM antibodies at first line of host defense (PubMed : 26735852).
See full target information Il17a

Additional targets

Il17f

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com