JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB259405

Recombinant mouse IL-3 protein (Active)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant mouse IL-3 protein (Active) is a Mouse Full Length protein, in the 33 to 166 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC, Cell Culture.

대체 명칭 보기

Csfmu, Il-3, Il3, Interleukin-3, IL-3, Hematopoietic growth factor, Mast cell growth factor, Multipotential colony-stimulating factor, P-cell-stimulating factor, MCGF

4 이미지
Mass Spectrometry - Recombinant mouse IL-3 protein (Active) (AB259405)
  • Mass Spec

Lab

Mass Spectrometry - Recombinant mouse IL-3 protein (Active) (AB259405)

M + 1.13 Da (calc mass 15159.87)

The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 μm, Thermo Scientific). 5 μL of purified protein was injected and the gradient run from 85 % water : FA (99.9 : 0.1 v/v) and 15 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) to 55 % water : FA (99.9 : 0.1 v/v) and 45 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).

Functional Studies - Recombinant mouse IL-3 protein (Active) (AB259405)
  • FuncS

Lab

Functional Studies - Recombinant mouse IL-3 protein (Active) (AB259405)

Fully biologically active when compared to standard. Determined by the dose-dependant Proliferation of M-NFS-60 cells.

ED50 is ≤ 0.1423 ng/mL, corresponding to a specific activity of 7.03 x 106 units/mg.

HPLC - Recombinant mouse IL-3 protein (Active) (AB259405)
  • HPLC

Supplier Data

HPLC - Recombinant mouse IL-3 protein (Active) (AB259405)

Purity : 98%

The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 μm). 5 μL of purified protein was injected and the gradient run from 80 % water : TFA (99.9 : 0.1 v/v) and 20 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) to 20 % water : TFA (99.9 : 0.1 v/v) and 80 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.

SDS-PAGE - Recombinant mouse IL-3 protein (Active) (AB259405)
  • SDS-PAGE

Lab

SDS-PAGE - Recombinant mouse IL-3 protein (Active) (AB259405)

SDS-PAGE analysis of ab259405.

주요 정보

Purity

>95% SDS-PAGE

Purity by HPLC >=95%.

Endotoxin 레벨

<0.005 EU/µg

발현 시스템

HEK 293 cells

Tags

Tag free

Applications

Mass Spec, SDS-PAGE, Cell Culture, HPLC, FuncS

applications

Biologically active

Yes

Biological activity

Fully biologically active when compared to standard. Determined by the dose-dependent Proliferation of M-NFS-60 cells. ED50 is ≤ 0.1423 ng/mL, corresponding to a specific activity of 7.03 x 106 units/mg.

Accession

Animal free

Yes

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute in PBS

보관 버퍼

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment

서열 정보

[{"linker":null,"sequence":"DTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC","proteinLength":"Full Length","predictedMolecularWeight":"15.16 kDa","actualMolecularWeight":null,"aminoAcidEnd":166,"aminoAcidStart":33,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P01586","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
Ambient
적절한 장기 보관 조건
Ambient
True

일반 정보

기능

Cytokine secreted predominantly by activated T-lymphocytes as well as mast cells and osteoblastic cells that controls the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Also stimulates mature basophils, eosinophils, and monocytes to become functionally activated. In addition, plays an important role in neural cell proliferation and survival. Participates as well in bone homeostasis and inhibits osteoclast differentiation by preventing NF-kappa-B nuclear translocation and activation. Mechanistically, exerts its biological effects through a receptor composed of IL3RA subunit and a signal transducing subunit IL3RB (By similarity). Receptor stimulation results in the rapid activation of JAK2 kinase activity leading to STAT5-mediated transcriptional program (PubMed : 10376805, PubMed : 31990690, PubMed : 8378315). Alternatively, contributes to cell survival under oxidative stress in non-hematopoietic systems by activating pathways mediated by PI3K/AKT and ERK (By similarity).

서열 유사성

Belongs to the IL-3 family.

제품 프로토콜

타겟 정보

Cytokine secreted predominantly by activated T-lymphocytes as well as mast cells and osteoblastic cells that controls the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Also stimulates mature basophils, eosinophils, and monocytes to become functionally activated. In addition, plays an important role in neural cell proliferation and survival. Participates as well in bone homeostasis and inhibits osteoclast differentiation by preventing NF-kappa-B nuclear translocation and activation. Mechanistically, exerts its biological effects through a receptor composed of IL3RA subunit and a signal transducing subunit IL3RB (By similarity). Receptor stimulation results in the rapid activation of JAK2 kinase activity leading to STAT5-mediated transcriptional program (PubMed : 10376805, PubMed : 31990690, PubMed : 8378315). Alternatively, contributes to cell survival under oxidative stress in non-hematopoietic systems by activating pathways mediated by PI3K/AKT and ERK (By similarity).
See full target information Il3

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com