JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB259406

Recombinant mouse IL-4 protein (Active)

Be the first to review this product! 리뷰 제출

|

(3 제품이 사용된 논문 )

Recombinant mouse IL-4 protein (Active) is a Mouse Full Length protein, in the 21 to 140 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC, Cell Culture.

대체 명칭 보기

Il-4, Il4, Interleukin-4, IL-4, B-cell IgG differentiation factor, B-cell growth factor 1, B-cell stimulatory factor 1, IGG1 induction factor, Lymphocyte stimulatory factor 1, BSF-1

4 이미지
Functional Studies - Recombinant mouse IL-4 protein (Active) (AB259406)
  • FuncS

Supplier Data

Functional Studies - Recombinant mouse IL-4 protein (Active) (AB259406)

Fully biologically active determined by dose dependent increase in HT-2 cell proliferation.

ED50 is ≤1.04 ng/ml, corresponding to a specific activity of 0.96 x 106 units/mg.

Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.

Lot : ​GR3372567-1​

Mass Spectrometry - Recombinant mouse IL-4 protein (Active) (AB259406)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant mouse IL-4 protein (Active) (AB259406)

Detarmination of mass by ESI TOF.

Predicted mass is 13615.11 Da (+/- 10 Da by ESI TOF). Observed mass is 13616.32 Da (and + 80 Da due to phosphorylation).

HPLC - Recombinant mouse IL-4 protein (Active) (AB259406)
  • HPLC

Supplier Data

HPLC - Recombinant mouse IL-4 protein (Active) (AB259406)

HPLC analysis of ab259406.

SDS-PAGE - Recombinant mouse IL-4 protein (Active) (AB259406)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant mouse IL-4 protein (Active) (AB259406)

SDS-PAGE analysis of ab259406.

주요 정보

Purity

>95% SDS-PAGE

=95%  by HPLC

Endotoxin 레벨

<0.005 EU/µg

발현 시스템

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE, FuncS, Cell Culture, HPLC, Mass Spec

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by dose dependent increase in HT-2 cell proliferation.

ED50 is ≤1.04 ng/ml, corresponding to a specific activity of 0.96 x 106 units/mg.

Accession

Animal free

Yes

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute in PBS

보관 버퍼

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS","proteinLength":"Full Length","predictedMolecularWeight":"13.62 kDa","actualMolecularWeight":"13.62 kDa","aminoAcidEnd":140,"aminoAcidStart":21,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P07750","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
Ambient
적절한 장기 보관 조건
Ambient
True

일반 정보

기능

Cytokine secreted primarily by mast cells, T-cells, eosinophils, and basophils that plays a role in regulating antibody production, hematopoiesis and inflammation, and the development of effector T-cell responses (PubMed : 3083412). Induces the expression of class II MHC molecules on resting B-cells (PubMed : 3498301). Enhances both secretion and cell surface expression of IgE and IgG1 (PubMed : 3498301). Also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes (By similarity). Positively regulates IL31RA expression in macrophages. Stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and through the induction of RUFY4 (PubMed : 26416964). In addition, plays a critical role in higher functions of the normal brain, such as memory and learning (PubMed : 25772794, PubMed : 28202615). Upon binding to IL4, IL4R receptor dimerizes either with the common IL2R gamma chain/IL2RG to produce the type 1 signaling complex, located mainly on hematopoietic cells, or with the IL13RA1 to produce the type 2 complex, which is also expressed on nonhematopoietic cells. Engagement of both types of receptors initiates JAK3 and to a lower extend JAK1 phosphorylation leading to activation of the signal transducer and activator of transcription 6/STAT6 (PubMed : 25847241, PubMed : 8624821).

서열 유사성

Belongs to the IL-4/IL-13 family.

제품 프로토콜

타겟 정보

Cytokine secreted primarily by mast cells, T-cells, eosinophils, and basophils that plays a role in regulating antibody production, hematopoiesis and inflammation, and the development of effector T-cell responses (PubMed : 3083412). Induces the expression of class II MHC molecules on resting B-cells (PubMed : 3498301). Enhances both secretion and cell surface expression of IgE and IgG1 (PubMed : 3498301). Also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes (By similarity). Positively regulates IL31RA expression in macrophages. Stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and through the induction of RUFY4 (PubMed : 26416964). In addition, plays a critical role in higher functions of the normal brain, such as memory and learning (PubMed : 25772794, PubMed : 28202615). Upon binding to IL4, IL4R receptor dimerizes either with the common IL2R gamma chain/IL2RG to produce the type 1 signaling complex, located mainly on hematopoietic cells, or with the IL13RA1 to produce the type 2 complex, which is also expressed on nonhematopoietic cells. Engagement of both types of receptors initiates JAK3 and to a lower extend JAK1 phosphorylation leading to activation of the signal transducer and activator of transcription 6/STAT6 (PubMed : 25847241, PubMed : 8624821).
See full target information Il4

제품이 사용된 논문 (3)

Recent publications for all applications. Explore the 전체 목록 and refine your search

Frontiers in immunology 16:1420325 PubMed40114914

2025

Mechanosensitivity of macrophage polarization: comparing small molecule leukadherin-1 to substrate stiffness.

Applications

Unspecified application

Species

Unspecified reactive species

Hemant Joshi,Edgar Anaya,Anvitha Addanki,Alison Almgren-Bell,Elizabeth M Todd,Sharon Celeste Morley

Cell biology and toxicology 41:44 PubMed39937362

2025

Enhancing cardiac repair post-myocardial infarction: a study on GATM/Gel hydrogel therapeutics.

Applications

Unspecified application

Species

Unspecified reactive species

Te Li,Lijuan Ding,Qiang Wang,Jianing Ma,Shudong Wang

Journal of clinical laboratory analysis 36:e24455 PubMed35524480

2022

Dioscin ameliorates inflammatory bowel disease by up-regulating miR-125a-5p to regulate macrophage polarization.

Applications

Unspecified application

Species

Unspecified reactive species

Lingyan Shi,Peichen Zhang,Ruifang Jin,Xiaowei Chen,Lemei Dong,Weichang Chen
제품이 사용된 논문 모두 보기

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com