JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB270065

Recombinant Mouse IL-7 protein (Active)

Be the first to review this product! 리뷰 제출

|

(1 출판물)

Recombinant Mouse IL-7 protein (Active) is a Mouse Full Length protein, in the 26 to 154 aa range, expressed in HEK 293 cells, with >95%, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC.

대체 명칭 보기

Il-7, Il7, Interleukin-7, IL-7

4 이미지
Mass Spectrometry - Recombinant Mouse IL-7 protein (Active) (AB270065)
  • Mass Spec

Lab

Mass Spectrometry - Recombinant Mouse IL-7 protein (Active) (AB270065)

Mass determination by ESI-TOF.

Predicted MW is 14954.22 Da (+/- 10 Da by ESI-TOF). Observed MW is 14956.73 Da.

Functional Studies - Recombinant Mouse IL-7 protein (Active) (AB270065)
  • FuncS

Supplier Data

Functional Studies - Recombinant Mouse IL-7 protein (Active) (AB270065)

Fully biologically active determined by the dose dependent proliferation of 2E8 cells.  ED50 is ≤ 0.3 ng/ml, corresponding to a specific activity of 3.3 x 10⁶ units/mg.  Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot. Lot GR3397741-2.

HPLC - Recombinant Mouse IL-7 protein (Active) (AB270065)
  • HPLC

Supplier Data

HPLC - Recombinant Mouse IL-7 protein (Active) (AB270065)

HPLC analysis of ab270065.

SDS-PAGE - Recombinant Mouse IL-7 protein (Active) (AB270065)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse IL-7 protein (Active) (AB270065)

SDS-PAGE analysis of ab270065.

주요 정보

Purity

>95% SDS-PAGE

Equal or greater than 95% by HPLC

발현 시스템

HEK 293 cells

Tags

Tag free

Applications

HPLC, SDS-PAGE, FuncS, Mass Spec

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the dose dependent proliferation of 2E8 cells.

ED50 is ≤ 0.3 ng/ml, corresponding to a specific activity of 3.3 x 106 units/mg.

Accession

Animal free

Yes

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute in PBS

보관 버퍼

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI","proteinLength":"Full Length","predictedMolecularWeight":"14.95 kDa","actualMolecularWeight":"14.96 kDa","aminoAcidEnd":154,"aminoAcidStart":26,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P10168","tags":[]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
Ambient
적절한 장기 보관 조건
Ambient
True

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Interleukin-7 (IL-7) also known as IL-7 protein or IL-7 is a cytokine with a critical role in immune system development and function. IL-7 has an approximate molecular mass of 25 kDa and it exhibits expression in several tissues including stromal cells in the bone marrow and thymus. It interacts with its specific receptor IL-7R which consists of the IL-7Rα chain and the common gamma chain (γc) shared with other cytokine receptors. These interactions are important for signaling pathways that support lymphoid tissue homeostasis.
Biological function summary

IL-7 significantly influences lymphocyte development and survival. It is essential for the proliferation and maintenance of T cells particularly thymocytes during T cell maturation and peripheral T cells after they exit the thymus. IL-7 does not form a complex itself but works as a critical single molecule in these processes. IL-7's role is especially noted in the maintenance of naïve and memory T cells important for adaptive immunity.

Pathways

IL-7 activity impacts important immune signaling routes. The cytokine is an important player in the JAK/STAT signaling pathway which gets activated upon IL-7R engagement. This pathway is fundamental in controlling T cell development proliferation and survival. IL-7's interaction with other proteins such as the IL-7R complex and their downstream signaling partners integrates it into networks critical for strengthening the immune response.

IL-7 is significantly linked to immunodeficiencies and cancers affecting immune cells. For instance IL-7's altered signaling is associated with severe combined immunodeficiencies (SCID) where the lack of functional IL-7 or its receptor compromises T cell development. Additionally overexpression of IL-7 has connections to certain leukemias and lymphomas where it may contribute to inappropriate lymphocyte proliferation. In these contexts IL-7 often gets investigated alongside proteins such as the JAK and STAT family involved in tumorigenesis and immune dysregulation.

일반 정보

기능

Hematopoietic cytokine that plays an essential role in the development, expansion, and survival of naive and memory T-cells and B-cells thereby regulating the number of mature lymphocytes and maintaining lymphoid homeostasis (PubMed : 28811625, PubMed : 7699333). Mechanistically, exerts its biological effects through a receptor composed of IL7RA subunit and the cytokine receptor common subunit gamma/CSF2RG. Binding to the receptor leads to activation of various kinases including JAK1 or JAK3 depending on the cell type and subsequently propagation of signals through activation of several downstream signaling pathways including the PI3K/Akt/mTOR or the JAK-STAT5.

서열 유사성

Belongs to the IL-7/IL-9 family.

Post-translational modifications

Three disulfide bonds are present.

제품 프로토콜

타겟 정보

Hematopoietic cytokine that plays an essential role in the development, expansion, and survival of naive and memory T-cells and B-cells thereby regulating the number of mature lymphocytes and maintaining lymphoid homeostasis (PubMed : 28811625, PubMed : 7699333). Mechanistically, exerts its biological effects through a receptor composed of IL7RA subunit and the cytokine receptor common subunit gamma/CSF2RG. Binding to the receptor leads to activation of various kinases including JAK1 or JAK3 depending on the cell type and subsequently propagation of signals through activation of several downstream signaling pathways including the PI3K/Akt/mTOR or the JAK-STAT5.
See full target information Il7

제품이 사용된 논문 (1)

Recent publications for all applications. Explore the 전체 목록 and refine your search

Journal of nanobiotechnology 22:575 PubMed39294599

2024

New insights into allergic rhinitis treatment: MSC nanovesicles targeting dendritic cells.

Applications

Unspecified application

Species

Unspecified reactive species

Jianyu Liu,Meiqun Wang,Xiaoyan Tian,Shuhong Wu,Haisen Peng,Yaqiong Zhu,Yuehui Liu
제품이 사용된 논문 모두 보기

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com