JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB215598

Recombinant Mouse IL1 Receptor I/IL-1R-1 protein (Fc Chimera)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Mouse IL1 Receptor I/IL-1R-1 protein (Fc Chimera) is a Mouse Fragment protein, in the 20 to 338 aa range, expressed in Mammalian, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

대체 명칭 보기

CD121a, Il-1r1, Il1ra, Il1r1, Interleukin-1 receptor type 1, IL-1R-1, IL-1RT-1, IL-1RT1, CD121 antigen-like family member A, Interleukin-1 receptor alpha, Interleukin-1 receptor type I, p80, IL-1R-alpha

주요 정보

Purity

>95% SDS-PAGE

Endotoxin 레벨

< 1 EU/µg

발현 시스템

Mammalian

Tags

Fc tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute in water

보관 버퍼

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

Previously labelled as IL1 Receptor I.

서열 정보

[{"linker":null,"sequence":"LEIDVCTEYPNQIVLFLSVNEIDIRKCPLTPNKMHGDTIIWYKNDSKTPISADRDSRIHQQNEHLWFVPAKVEDSGYYYCIVRNSTYCLKTKVTVTVLENDPGLCYSTQATFPQRLHIAGDGSLVCPYVSYFKDENNELPEVQWYKNCKPLLLDNVSFFGVKDKLLVRNVAEEHRGDYICRMSYTFRGKQYPVTRVIQFITIDENKRDRPVILSPRNETIEADPGSMIQLICNVTGQFSDLVYWKWNGSEIEWNDPFLAEDYQFVEHPSTKRKYTLITTLNISEVKSQFYRYPFICVVKNTNIFESAHVQLIYPVPDFKIEGRDMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK","proteinLength":"Fragment","predictedMolecularWeight":"64 kDa","actualMolecularWeight":null,"aminoAcidEnd":338,"aminoAcidStart":20,"nature":"Recombinant","expressionSystem":"Mammalian","accessionNumber":"P13504","tags":[{"tag":"Fc","terminus":"C-Terminus"}]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

The IL-1 Receptor I also known as IL-1R1 is a transmembrane protein with alternative names such as IL-1 receptor and IL-1 type I receptor. It acts as an important receptor for the pro-inflammatory cytokine Interleukin-1 (IL-1) family primarily IL-1α and IL-1β. IL-1R1 has a mass of approximately 80 kilodaltons and is expressed in a variety of cell types including endothelial cells epithelial cells and fibroblasts. It is also present on immune cells like monocytes and macrophages making it widespread in a vast range of tissues.
Biological function summary

IL-1R1 is a critical player in the initiation of immune responses serving as a component of the IL-1 signaling complex. When IL-1 binds to IL-1R1 it recruits the IL-1 receptor accessory protein (IL-1RAcP) to form a signaling complex that triggers downstream pathways. This interaction initiates a signaling cascade that activates nuclear factor-kappa B (NF-κB) and mitogen-activated protein kinases (MAPKs) promoting the expression of inflammatory genes and mediating immune and inflammatory responses.

Pathways

IL-1R1 is central to the inflammatory response and immune signaling pathways. The IL-1 receptor complex facilitates the activation of NF-κB which plays a role in the body's response to stress cytokines and pathogens. The receptor acts in close relation with other proteins like IL-1RAcP and IRAKs (Interleukin-1 receptor-associated kinases) in these pathways creating a robust immune signaling network that drives the inflammatory response.

IL-1R1 is closely associated with inflammatory conditions such as rheumatoid arthritis and inflammatory bowel disease. Increased IL-1R1 expression and signaling contribute to chronic inflammation in these diseases. The interaction of IL-1β with IL-1R1 and subsequently with proteins like NF-κB leads to the persistence of inflammatory signals. Moreover targeting IL-1R1 and related proteins offers potential therapeutic strategies in mitigating the symptoms and progression of inflammatory disorders.

일반 정보

기능

Receptor for IL1A, IL1B and IL1RN. After binding to interleukin-1 associates with the coreceptor IL1RAP to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation of NF-kappa-B, MAPK and other pathways. Signaling involves the recruitment of adapter molecules such as TOLLIP, MYD88, and IRAK1 or IRAK2 via the respective TIR domains of the receptor/coreceptor subunits. Binds ligands with comparable affinity and binding of antagonist IL1RN prevents association with IL1RAP to form a signaling complex. Involved in IL1B-mediated costimulation of IFNG production from T-helper 1 (Th1) cells (By similarity).. Isoform 2. Unable to mediate canonical IL-1 signaling. Cooperates with IL1RAP isoform 3 to mediate IL1B-induced neuronal activity including IL1B-potentiated NMDA-induced calcium influx mediated by Akt kinase activation.

서열 유사성

Belongs to the interleukin-1 receptor family.

Post-translational modifications

A soluble form (sIL1R1) is probably produced by proteolytic cleavage at the cell surface (shedding).. Rapidly phosphorylated on Tyr-499 in response to IL-1, which creates a SH2 binding site for the PI 3-kinase regulatory subunit PIK3R1.

제품 프로토콜

타겟 정보

Receptor for IL1A, IL1B and IL1RN. After binding to interleukin-1 associates with the coreceptor IL1RAP to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation of NF-kappa-B, MAPK and other pathways. Signaling involves the recruitment of adapter molecules such as TOLLIP, MYD88, and IRAK1 or IRAK2 via the respective TIR domains of the receptor/coreceptor subunits. Binds ligands with comparable affinity and binding of antagonist IL1RN prevents association with IL1RAP to form a signaling complex. Involved in IL1B-mediated costimulation of IFNG production from T-helper 1 (Th1) cells (By similarity).. Isoform 2. Unable to mediate canonical IL-1 signaling. Cooperates with IL1RAP isoform 3 to mediate IL1B-induced neuronal activity including IL1B-potentiated NMDA-induced calcium influx mediated by Akt kinase activation.
See full target information Il1r1

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com