JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB235821

Recombinant Mouse Myoglobin protein (Tagged)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Mouse Myoglobin protein (Tagged) is a Mouse Full Length protein, in the 2 to 154 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

대체 명칭 보기

Myoglobin, Nitrite reductase MB, Pseudoperoxidase MB, Mb

3 이미지
Mass Spectrometry - Recombinant Mouse Myoglobin protein (Tagged) (AB235821)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Mouse Myoglobin protein (Tagged) (AB235821)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab235821 could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Mb.

Mass Spectrometry - Recombinant Mouse Myoglobin protein (Tagged) (AB235821)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Mouse Myoglobin protein (Tagged) (AB235821)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab235821 could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Mb.

SDS-PAGE - Recombinant Mouse Myoglobin protein (Tagged) (AB235821)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse Myoglobin protein (Tagged) (AB235821)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5%wnrichment gel and 15% separation gel of ab235821.

주요 정보

Purity

>90% SDS-PAGE

발현 시스템

Escherichia coli

Tags

10x His tag N-Terminus Myc tag C-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Mouse

보관 버퍼

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG","proteinLength":"Full Length","predictedMolecularWeight":"21.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":154,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P04247","tags":[{"tag":"10x His","terminus":"N-Terminus"},{"tag":"Myc","terminus":"C-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Myoglobin also known as MB is a small globular protein with a molecular weight of approximately 17 kDa. It functions as an oxygen-binding protein and is expressed mainly in cardiac and skeletal muscle tissue where it facilitates oxygen storage and transport. The myoglobin protein plays an important role in maintaining the oxygen supply needed during muscular contraction and intense physical activity.
Biological function summary

Myoglobin in muscle cells acts to store oxygen which provides a rapid release when required during muscle contraction. Myoglobin serves as a monomer and does not form part of a complex. Its structure allows it to temporarily store and relay oxygen where it is most required enhancing the often abrupt demands of muscles for oxygen. The ability of myoglobin to bind oxygen and release it under hypoxic conditions is central to its biological role in vertebrates.

Pathways

The function of myoglobin in aerobic respiration in muscles involves its participation in the oxygen transport pathway. This protein closely interacts with hemoglobin to mobilize oxygen effectively to mitochondria during muscle contraction. Unlike hemoglobin myoglobin has a hyperbolic oxygen dissociation curve which allows it to provide oxygen at lower partial pressures contributing significantly to the efficient metabolism during hypoxia or intense muscular exertion.

Myoglobin plays a significant role in conditions such as rhabdomyolysis and myocardial infarction. Rhabdomyolysis a syndrome caused by muscle injury results in the release of myoglobin into the bloodstream. Myoglobin detection kits including myoglobin ELISA are essential tools for the diagnosis of these conditions. Moreover its rapid increase in plasma levels after heart muscle damage enables its use as an early marker for myocardial infarction. Myoglobin's interaction with proteins like creatine kinase provides valuable information on muscle damage and cardiac events.

일반 정보

기능

Monomeric heme protein which primary function is to store oxygen and facilitate its diffusion within muscle tissues. Reversibly binds oxygen through a pentacoordinated heme iron and enables its timely and efficient release as needed during periods of heightened demand (PubMed : 10468637, PubMed : 11304494). Depending on the oxidative conditions of tissues and cells, and in addition to its ability to bind oxygen, it also has a nitrite reductase activity whereby it regulates the production of bioactive nitric oxide (By similarity). Under stress conditions, like hypoxia and anoxia, it also protects cells against reactive oxygen species thanks to its pseudoperoxidase activity (PubMed : 15132981).

서열 유사성

Belongs to the globin family.

제품 프로토콜

타겟 정보

Monomeric heme protein which primary function is to store oxygen and facilitate its diffusion within muscle tissues. Reversibly binds oxygen through a pentacoordinated heme iron and enables its timely and efficient release as needed during periods of heightened demand (PubMed : 10468637, PubMed : 11304494). Depending on the oxidative conditions of tissues and cells, and in addition to its ability to bind oxygen, it also has a nitrite reductase activity whereby it regulates the production of bioactive nitric oxide (By similarity). Under stress conditions, like hypoxia and anoxia, it also protects cells against reactive oxygen species thanks to its pseudoperoxidase activity (PubMed : 15132981).
See full target information Mb

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com