JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB216248

Recombinant mouse PD1 protein (Fc tag C-Terminus)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant mouse PD1 protein (Fc tag C-Terminus) is a Mouse Fragment protein, in the 25 to 167 aa range, expressed in HEK 293 cells, with >90%, suitable for SDS-PAGE, FuncS.

대체 명칭 보기

CD279, Pd1, Pdcd1, Programmed cell death protein 1, Protein PD-1, mPD-1

2 이미지
Size Exclusion Chromatography - Recombinant mouse PD1 protein (Fc tag C-Terminus) (AB216248)
  • Size Exclusion Chromatography

Supplier Data

Size Exclusion Chromatography - Recombinant mouse PD1 protein (Fc tag C-Terminus) (AB216248)

Gel filtration curve of ab216248.

SDS-PAGE - Recombinant mouse PD1 protein (Fc tag C-Terminus) (AB216248)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant mouse PD1 protein (Fc tag C-Terminus) (AB216248)

4-20% SDS-PAGE using 3μg of ab216248.

주요 정보

Purity

>90% SDS-PAGE

발현 시스템

HEK 293 cells

Tags

Fc tag C-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Active

Accession

Animal free

No

Carrier free

No

Species

Mouse

보관 버퍼

pH: 7.4 Constituents: 79% Phosphate Buffer, 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.02% Potassium chloride

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>Useful for the study of protein-protein interaction and <em>in vitro</em> and <em>in vivo</em> protein function studies.</p>" } } }

제품 세부 정보

Protein may be diluted to ≥ 100 μg/ml in PBS + glycerol and stored at -80°C.

서열 정보

[{"linker":null,"sequence":"LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ","proteinLength":"Fragment","predictedMolecularWeight":"43.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":167,"aminoAcidStart":25,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q02242","tags":[{"tag":"Fc","terminus":"C-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-80°C
적절한 장기 보관 조건
-80°C
보관 정보
Avoid freeze / thaw cycle
True

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

PD1 also known as Programmed Cell Death Protein 1 or PDCD1 is a transmembrane protein that plays a critical role in regulating immune responses. It has a mass of approximately 55 kDa. PD1 is expressed on the surface of T cells B cells and some myeloid cells. PD1’s expression increases upon activation of these immune cells assisting in maintaining peripheral tolerance. Researchers often use PD1 mouse models and chimeric antibodies to explore the function of PD1 for experimental purposes. Antibodies such as anti-PD1 such as EH12.2H7 help in blocking PD1 interaction to study its role further.
Biological function summary

PD1 serves as an inhibitory receptor acting as a checkpoint in the immune system. It becomes part of an immune-suppressive complex when it binds with its ligands PD-L1 or PD-L2 which are expressed on various cell types including some tumor cells. This interaction suppresses the proliferation of T cells and cytokine production contributing to immune homeostasis. By controlling T cell activity PD1 limits autoimmunity but can also reduce the immune system's capability to attack cancer cells.

Pathways

PD1 functions in the immune checkpoint pathway a critical regulatory circuit in immune regulation. The engagement of PD1 with its ligands initiates a cascade that inhibits the function and proliferation of T cells through downstream SHP-2 phosphatase activity. This pathway frequently involves other regulatory proteins like CTLA-4 and is an important mechanism by which the body modulates immune responses. Related pathways often intersect with those involving T cell receptor signaling and contribute to the overall modulation of immune activity.

PD1 has a significant role in cancer and autoimmune disorders. PD1 expression can allow tumors to evade immune surveillance making PD1 a target for cancer therapies such as anti-PD1 antibodies which aim to block PD1 and restore T cell activity. The interaction of PD1 with cancer-related proteins like PD-L1 facilitates tumor immune evasion. In autoimmune disorders PD1’s regulation of immune balance can become dysregulated leading to persistent immune activation and tissue damage. Understanding PD1 and its interaction with proteins such as PD-L1 helps in developing therapeutic strategies for both cancer and autoimmune conditions.

일반 정보

기능

Inhibitory receptor on antigen activated T-cells that plays a critical role in induction and maintenance of immune tolerance to self (PubMed : 10485649, PubMed : 11209085, PubMed : 11698646, PubMed : 21300912). Delivers inhibitory signals upon binding to ligands, such as CD274/PDCD1L1 and CD273/PDCD1LG2 (PubMed : 11015443, PubMed : 11224527, PubMed : 18287011, PubMed : 18641123, PubMed : 22641383). Following T-cell receptor (TCR) engagement, PDCD1 associates with TCR-CD3 in the immunological synapse and directly inhibits T-cell activation (PubMed : 22641383). Suppresses T-cell activation through the recruitment of PTPN11/SHP-2 : following ligand-binding, PDCD1 is phosphorylated within the ITSM motif, leading to the recruitment of the protein tyrosine phosphatase PTPN11/SHP-2 that mediates dephosphorylation of key TCR proximal signaling molecules, such as ZAP70, PRKCQ/PKCtheta and CD247/CD3zeta (PubMed : 11698646, PubMed : 22641383). The PDCD1-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and facilitate tumor survival (By similarity).

Post-translational modifications

Ubiquitinated at Lys-235 by the SCF(FBXO38) complex, leading to its proteasomal degradation. Ubiquitinated via 'Lys-48'-linked polyubiquitin chains. Deubiquitinated and thus stabilized by USP5.. Tyrosine phosphorylated at Tyr-225 (within ITIM motif) and Tyr-248 (ITSM motif) upon ligand binding (PubMed:11698646, PubMed:22641383). Phosphorylation at Tyr-248 by FYN promotes the recruitment of the protein tyrosine phosphatase PTPN11/SHP-2 that mediates dephosphorylation of key TCR proximal signaling molecules, such as ZAP70, PRKCQ/PKCtheta and CD247/CD3zeta (PubMed:22641383). Phosphorylation at Thr-236 promotes the recruitment of the deubiquitinase USP5 (By similarity).

제품 프로토콜

타겟 정보

Inhibitory receptor on antigen activated T-cells that plays a critical role in induction and maintenance of immune tolerance to self (PubMed : 10485649, PubMed : 11209085, PubMed : 11698646, PubMed : 21300912). Delivers inhibitory signals upon binding to ligands, such as CD274/PDCD1L1 and CD273/PDCD1LG2 (PubMed : 11015443, PubMed : 11224527, PubMed : 18287011, PubMed : 18641123, PubMed : 22641383). Following T-cell receptor (TCR) engagement, PDCD1 associates with TCR-CD3 in the immunological synapse and directly inhibits T-cell activation (PubMed : 22641383). Suppresses T-cell activation through the recruitment of PTPN11/SHP-2 : following ligand-binding, PDCD1 is phosphorylated within the ITSM motif, leading to the recruitment of the protein tyrosine phosphatase PTPN11/SHP-2 that mediates dephosphorylation of key TCR proximal signaling molecules, such as ZAP70, PRKCQ/PKCtheta and CD247/CD3zeta (PubMed : 11698646, PubMed : 22641383). The PDCD1-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and facilitate tumor survival (By similarity).
See full target information Pdcd1

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com