JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB236330

Recombinant Mouse PPAR gamma protein (His tag)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Mouse PPAR gamma protein (His tag) is a Mouse Full Length protein, in the 1 to 505 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE.

대체 명칭 보기

Nr1c3, Pparg, Peroxisome proliferator-activated receptor gamma, PPAR-gamma, Nuclear receptor subfamily 1 group C member 3

1 이미지
SDS-PAGE - Recombinant Mouse PPAR gamma protein (His tag) (AB236330)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse PPAR gamma protein (His tag) (AB236330)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab236330.

주요 정보

Purity

>85% SDS-PAGE

발현 시스템

Escherichia coli

Tags

10x His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Mouse

보관 버퍼

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY","proteinLength":"Full Length","predictedMolecularWeight":"63.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":505,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P37238","tags":[{"tag":"10x His","terminus":"N-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

일반 정보

기능

Ligand-activated transcription factor that forms obligate heterodimers with the retinoic acid receptor and acts as a key regulator of biological processes, such as adipocyte differentiation, lipid metabolism, glucose homeostasis and beta-oxidation of fatty acids (PubMed : 21035761, PubMed : 23525231, PubMed : 7838715, PubMed : 7926726, PubMed : 8041794, PubMed : 8262913). Activated by lipid ligands : binds peroxisome proliferators, such as hypolipidemic drugs, and fatty acids, such as prostaglandin J2 metabolites (PubMed : 21994940, PubMed : 27197753, PubMed : 8041794, PubMed : 8262913). Ligand-binding results in a conformational change in the receptor, promoting dissociation of repressors and recruitment of coactivators, and subsequent activation of target gene expression (PubMed : 21994940, PubMed : 27197753, PubMed : 8041794, PubMed : 8262913). Specifically binds to DNA specific PPAR response elements (PPRE) and modulates the transcription of its target genes, such as acyl-CoA oxidase (PubMed : 8041794, PubMed : 8262913). Acts as a critical regulator of gut homeostasis by suppressing NF-kappa-B-mediated pro-inflammatory responses (By similarity). Plays a role in the regulation of cardiovascular circadian rhythms by regulating the transcription of BMAL1 in the blood vessels (PubMed : 19041764).. Isoform 2. Nuclear receptor that acts as the key factor controlling the development of adipocytes (PubMed : 10549290, PubMed : 10549291, PubMed : 10549292, PubMed : 18719582, PubMed : 21459326, PubMed : 23473036, PubMed : 7838715, PubMed : 7926726, PubMed : 8001151, PubMed : 8521497, PubMed : 8521498). Specifically activated by 15-deoxy-delta12,14-prostaglandin J2 ligand during early adipogenesis, driving differentiation of all types of adipocytes (white, beige and brown) (PubMed : 7838715, PubMed : 7926726, PubMed : 8521497, PubMed : 8521498). Acts together with retinoic acid receptor RXRA, forming the ARF6 complex, which acts as a key regulator of the tissue-specific adipocyte P2 (aP2) enhancer (PubMed : 7838715). Following recruitment of TLE3, promotes differentiation of white adipocytes (PubMed : 21459326, PubMed : 23473036). Following recruitment of PRDM16, promotes differentiation of myoblastic precursors into brown adipose cells (BAT), which are specialized in dissipating energy in the form of heat in response to cold or excess feeding (PubMed : 18719582, PubMed : 24703692, PubMed : 40355558). Also mediates diffentiation of white adipocytes into beige adipocytes by mediating recruitment of PRDM16 (PubMed : 22405074).

서열 유사성

Belongs to the nuclear hormone receptor family. NR1 subfamily.

Post-translational modifications

O-GlcNAcylation at Thr-84 reduces transcriptional activity in adipocytes.. Phosphorylated in basal conditions and dephosphorylated when treated with the ligand. May be dephosphorylated by PPP5C. The phosphorylated Ser-112 form is recognized by PER2 and repressed, dephosphorylation at Ser-112 induces adipogenic activity. Ser-112 phosphorylation levels are reduced by 65% in brown adipose tissue compared to white adipose tissue.. Ubiquitinated by E3 ubiquitin-protein ligase complex containing FBXO9; leading to proteasomal degradation (PubMed:27197753). Ubiquitinated at Lys-252 by TRIM55 leading to proteasomal degradation (By similarity). Ubiquitinated by E3 ubiquitin-protein ligase STUB1/CHIP; leading to proteasomal degradation (PubMed:35710596). Ubiquitinated by E3 ubiquitin-protein ligase ARIH2; leading to proteasomal degradation (PubMed:40355558).

Subcellular localisation

Nucleus

제품 프로토콜

타겟 정보

Ligand-activated transcription factor that forms obligate heterodimers with the retinoic acid receptor and acts as a key regulator of biological processes, such as adipocyte differentiation, lipid metabolism, glucose homeostasis and beta-oxidation of fatty acids (PubMed : 21035761, PubMed : 23525231, PubMed : 7838715, PubMed : 7926726, PubMed : 8041794, PubMed : 8262913). Activated by lipid ligands : binds peroxisome proliferators, such as hypolipidemic drugs, and fatty acids, such as prostaglandin J2 metabolites (PubMed : 21994940, PubMed : 27197753, PubMed : 8041794, PubMed : 8262913). Ligand-binding results in a conformational change in the receptor, promoting dissociation of repressors and recruitment of coactivators, and subsequent activation of target gene expression (PubMed : 21994940, PubMed : 27197753, PubMed : 8041794, PubMed : 8262913). Specifically binds to DNA specific PPAR response elements (PPRE) and modulates the transcription of its target genes, such as acyl-CoA oxidase (PubMed : 8041794, PubMed : 8262913). Acts as a critical regulator of gut homeostasis by suppressing NF-kappa-B-mediated pro-inflammatory responses (By similarity). Plays a role in the regulation of cardiovascular circadian rhythms by regulating the transcription of BMAL1 in the blood vessels (PubMed : 19041764).. Isoform 2. Nuclear receptor that acts as the key factor controlling the development of adipocytes (PubMed : 10549290, PubMed : 10549291, PubMed : 10549292, PubMed : 18719582, PubMed : 21459326, PubMed : 23473036, PubMed : 7838715, PubMed : 7926726, PubMed : 8001151, PubMed : 8521497, PubMed : 8521498). Specifically activated by 15-deoxy-delta12,14-prostaglandin J2 ligand during early adipogenesis, driving differentiation of all types of adipocytes (white, beige and brown) (PubMed : 7838715, PubMed : 7926726, PubMed : 8521497, PubMed : 8521498). Acts together with retinoic acid receptor RXRA, forming the ARF6 complex, which acts as a key regulator of the tissue-specific adipocyte P2 (aP2) enhancer (PubMed : 7838715). Following recruitment of TLE3, promotes differentiation of white adipocytes (PubMed : 21459326, PubMed : 23473036). Following recruitment of PRDM16, promotes differentiation of myoblastic precursors into brown adipose cells (BAT), which are specialized in dissipating energy in the form of heat in response to cold or excess feeding (PubMed : 18719582, PubMed : 24703692, PubMed : 40355558). Also mediates diffentiation of white adipocytes into beige adipocytes by mediating recruitment of PRDM16 (PubMed : 22405074).
See full target information Pparg

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com