JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB236328

Recombinant Mouse SULT1A1/STP protein (Tagged)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Mouse SULT1A1/STP protein (Tagged) is a Mouse Full Length protein, in the 1 to 291 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

대체 명칭 보기

St1a1, Stp, Stp1, Sult1a1, Sulfotransferase 1A1, ST1A1, Aryl sulfotransferase, Phenol sulfotransferase, Phenol/aryl sulfotransferase, ST1A4, Sulfokinase, mSTp1

3 이미지
Mass Spectrometry - Recombinant Mouse SULT1A1/STP protein (Tagged) (AB236328)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Mouse SULT1A1/STP protein (Tagged) (AB236328)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab236328 could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) SULT1A1/STP.

Mass Spectrometry - Recombinant Mouse SULT1A1/STP protein (Tagged) (AB236328)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Mouse SULT1A1/STP protein (Tagged) (AB236328)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab236328 could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) SULT1A1/STP.

SDS-PAGE - Recombinant Mouse SULT1A1/STP protein (Tagged) (AB236328)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse SULT1A1/STP protein (Tagged) (AB236328)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab236328.

주요 정보

Purity

>90% SDS-PAGE

발현 시스템

Escherichia coli

Tags

10x His tag N-Terminus SUMO tag N-Terminus Myc tag C-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Mouse

보관 버퍼

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

제품 세부 정보

This product was previously labelled as SULT1A1

서열 정보

[{"linker":null,"sequence":"MEPLRKPLVPVKGIPLIKYFAETMEQLQNFTAWPDDVLISTYPKSGTNWMSEIMDMIYQGGKLDKCGRAPVYARIPFLEFSCPGVPPGLETLKETPAPRIIKTHLPLSLLPQSLLDQKIKVIYVARNAKDVVVSYYNFYKMAKLHPDPGTWESFLENFMDGKVSYGSWYQHVKEWWELRRTHPVLYLFYEDMKENPKREIKKILEFLGRSLPEETVDLIVHHTSFKKMKENPMANYTTIPTEVMDHTIYPFMRKGTIGDWKNTFTVAQSEHFDAHYAKLMTGCDFTFRCQI","proteinLength":"Full Length","predictedMolecularWeight":"54 kDa","actualMolecularWeight":null,"aminoAcidEnd":291,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P52840","tags":[{"tag":"10x His","terminus":"N-Terminus"},{"tag":"SUMO","terminus":"N-Terminus"},{"tag":"Myc","terminus":"C-Terminus"}]}]

특성 및 보관 정보

제형
Liquid
배송 시 보관 조건
Blue Ice
적절한 단기 보관 조건
-20°C
적절한 장기 보관 조건
-20°C
분주 정보
Upon delivery aliquot
보관 정보
Avoid freeze / thaw cycle
False

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

SULT1A1 also known as STP is an enzyme that plays an important role in the metabolism of various hormones drugs and other xenobiotic compounds. It belongs to the sulfotransferase family responsible for catalyzing the sulfate conjugation of many endogenous and exogenous compounds. SULT1A1 has a molecular mass of approximately 34 kDa. The enzyme is highly expressed in the liver but is also found in other tissues like the intestine and lung. It facilitates the transfer of a sulfo group from the universal sulfate donor 3’-phosphoadenosine-5’-phosphosulfate (PAPS) to substrates such as phenolic compounds.
Biological function summary

The enzyme contributes significantly to the detoxification and activation of its substrates in the body. SULT1A1 functions without being part of a larger protein complex allowing it direct interaction with its substrates. By modifying hormones such as estrogens and catecholamines it helps regulate their activity and half-life. Additionally SULT1A1 plays a role in the metabolic processing of drugs influencing their pharmacokinetics and pharmacodynamics.

Pathways

SULT1A1 is a critical component of both the phenolic metabolism pathway and the metabolism of xenobiotics by cytochrome P450. These pathways involve other proteins like CYP2C9 and GSTP1 which participate in further detoxification and conjugation reactions. Within these pathways SULT1A1 contributes to the inactivation or activation of compounds altering their biological activity and facilitating their excretion from the body.

SULT1A1 has been associated with variable drug responses and certain cancers. Altered activity of this enzyme can influence clearance of drugs potentially leading to adverse drug reactions or therapeutic failure. Moreover the dysregulation of estrogen metabolism partly mediated by SULT1A1 may contribute to hormone-related cancers such as breast cancer. The enzyme's interaction with proteins like UGT1A1 within these disease contexts highlights its role in the broader framework of metabolic processes impacting health and disease outcomes.

일반 정보

기능

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of a wide variety of acceptor molecules bearing a hydroxyl or an amine group. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Displays broad substrate specificity for small phenolic compounds. Plays an important role in the sulfonation of endogenous molecules such as steroid hormones (By similarity). Mediates also the metabolic activation of carcinogenic N-hydroxyarylamines leading to highly reactive intermediates capable of forming DNA adducts, potentially resulting in mutagenesis (By similarity). May play a role in gut microbiota-host metabolic interaction. O-sulfonates 4-ethylphenol (4-EP), a dietary tyrosine-derived metabolite produced by gut bacteria. The product 4-EPS crosses the blood-brain barrier and may negatively regulate oligodendrocyte maturation and myelination, affecting the functional connectivity of different brain regions associated with the limbic system. Catalyzes the sulfate conjugation of dopamine. Catalyzes the sulfation of T4 (L-thyroxine/3,5,3',5'-tetraiodothyronine), T3 (3,5,3'-triiodothyronine), rT3 (3,3',5'-triiodothyronine) and 3,3'-T2 (3,3'-diiodothyronine), with a substrate preference of 3,3'-T2 > rT3 > T3 > T4 (By similarity).

서열 유사성

Belongs to the sulfotransferase 1 family.

제품 프로토콜

타겟 정보

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of a wide variety of acceptor molecules bearing a hydroxyl or an amine group. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Displays broad substrate specificity for small phenolic compounds. Plays an important role in the sulfonation of endogenous molecules such as steroid hormones (By similarity). Mediates also the metabolic activation of carcinogenic N-hydroxyarylamines leading to highly reactive intermediates capable of forming DNA adducts, potentially resulting in mutagenesis (By similarity). May play a role in gut microbiota-host metabolic interaction. O-sulfonates 4-ethylphenol (4-EP), a dietary tyrosine-derived metabolite produced by gut bacteria. The product 4-EPS crosses the blood-brain barrier and may negatively regulate oligodendrocyte maturation and myelination, affecting the functional connectivity of different brain regions associated with the limbic system. Catalyzes the sulfate conjugation of dopamine. Catalyzes the sulfation of T4 (L-thyroxine/3,5,3',5'-tetraiodothyronine), T3 (3,5,3'-triiodothyronine), rT3 (3,3',5'-triiodothyronine) and 3,3'-T2 (3,3'-diiodothyronine), with a substrate preference of 3,3'-T2 > rT3 > T3 > T4 (By similarity).
See full target information Sult1a1

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com