JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB291058

Recombinant Mouse TIMP1 Protein (Active)

Be the first to review this product! 리뷰 제출

|

(0 출판물)

Recombinant Mouse TIMP1 Protein (Active) is a Mouse Fragment protein, in the 25 to 205 aa range, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, Mass Spec, FuncS.

대체 명칭 보기

Timp, Timp-1, Timp1, Metalloproteinase inhibitor 1, Collagenase inhibitor 16C8 fibroblast, Erythroid-potentiating activity, TPA-S1, TPA-induced protein, Tissue inhibitor of metalloproteinases 1, EPA, TIMP-1

3 이미지
Functional Studies - Recombinant Mouse TIMP1 Protein (Active) (AB291058)
  • FuncS

Supplier Data

Functional Studies - Recombinant Mouse TIMP1 Protein (Active) (AB291058)

Fully active determined by its ability to inhibit human MMP2 cleavage of a chromogenic peptide substrate (Mca-PLGL[1]Dpa-AR-NH2). ED50 is ≤ 2.8 ng/ml, corresponding to a specific activity of 3.6 x 105 units/mg.

Mass Spectrometry - Recombinant Mouse TIMP1 Protein (Active) (AB291058)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Mouse TIMP1 Protein (Active) (AB291058)

Mass determination by ESI-TOF.

Observed MW is 21063.19 Da (+/- 10 Da by ESI-TOF).

SDS-PAGE - Recombinant Mouse TIMP1 Protein (Active) (AB291058)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse TIMP1 Protein (Active) (AB291058)

SDS-PAGE of ab291058

주요 정보

Purity

>95% SDS-PAGE

Endotoxin 레벨

<0.005 EU/µg

Tags

His tag C-Terminus

Applications

Mass Spec, FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Fully active determined by its ability to inhibit human MMP2 cleavage of a chromogenic peptide substrate (Mca-PLGL[1]Dpa-AR-NH2).

ED50 is ≤ 2.8 ng/ml, corresponding to a specific activity of 3.6 x 105 units/mg.

Accession

Animal free

No

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute in PBS

보관 버퍼

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity 정보

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

서열 정보

[{"linker":null,"sequence":"CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR","proteinLength":"Fragment","predictedMolecularWeight":"23 kDa","actualMolecularWeight":null,"aminoAcidEnd":205,"aminoAcidStart":25,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P12032","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

특성 및 보관 정보

제형
Lyophilized
배송 시 보관 조건
Ambient - Can Ship with Ice
적절한 단기 보관 조건
Ambient
적절한 장기 보관 조건
Ambient
True

추가 정보

This supplementary information is collated from multiple sources and compiled automatically.

Tissue Inhibitor of Metalloproteinase 1 (TIMP1) is a protein with a molecular mass of approximately 28 kDa. The protein inhibits metalloproteinases by binding to them preventing the breakdown of the extracellular matrix. This action regulates extracellular environment and tissue remodeling. TIMP1 is also known by the name Erythroid-Potentiating Activity (EPA). It is expressed in various tissues including the liver and the brain and can be found in high levels in the blood serum.
Biological function summary

TIMP1 plays several essential roles beyond inhibiting metalloproteinases. It supports cell proliferation and influences apoptosis. It is part of a larger TIMP family and does not function as part of a complex per se but interacts closely with matrix metalloproteinases (MMPs). By regulating MMP activity TIMP1 balances processes like tissue growth and inflammatory responses which are important for normal development and repair.

Pathways

TIMP1 participates in the regulation of the matrix metalloproteinase pathway impacting tissue homeostasis and repair. It closely associates with proteins such as MMP-9 and MMP-2 within this pathway. TIMP1 also plays a role in cytokine signaling pathways which influence immune responses by interacting with other signaling molecules and receptors that govern these pathways.

TIMP1's regulation of MMPs links it to cancer and cardiovascular disease progression. Overexpression of TIMP1 associates with tumor growth and metastasis where it can modulate interactions with other proteins like MMP-9 leading to altered tissue invasion and angiogenesis. Additionally TIMP1 imbalance connects to tissue fibrosis in cardiovascular disorders working in tandem with proteins such as MMP-2 which affects the structural remodeling and function of tissues within the cardiovascular system.

일반 정보

기능

Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14 (By similarity). Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling.

서열 유사성

Belongs to the protease inhibitor I35 (TIMP) family.

Post-translational modifications

The activity of TIMP1 is dependent on the presence of disulfide bonds.. N-glycosylated.

제품 프로토콜

타겟 정보

Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14 (By similarity). Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling.
See full target information Timp1

Product promise

저희는 고품질 시약으로 고객님의 연구를 서포트하고자 최선을 다하고 있으며, 모든 단계에서 함께 하겠습니다. 만약 제품이 기대한 성능을 보이지 않을 경우에도 Product Promise로 보호받으실 수 있습니다.
자세한 내용은 이용 약관을 확인해 주세요.

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com