Overview

  • Product name

    Anti-KPNA4 antibody [3D10]
    See all KPNA4 primary antibodies
  • Description

    Rat monoclonal [3D10] to KPNA4
  • Host species

    Rat
  • Specificity

    ab180657 does not recognize other members of the importin alpha family, including alpha 4.
  • Tested applications

    Suitable for: WB, ELISAmore details
    Unsuitable for: IHC or IP
  • Species reactivity

    Reacts with: Mouse, Rat, Hamster, Cow, Dog, Human, Monkey
  • Immunogen

    Recombinant full length protein corresponding to Mouse KPNA4 aa 1-521.
    Sequence:

    MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRN VPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLS SDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQT QAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGV VKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVL IHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKV QTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFL SNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGR KDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDEAETIG NLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDDIDEDPSLVPEA IQGGTFGFNSSANVPTEGFQF


    Database link: O35343

  • Positive control

    • Whole extracts from HeLa, COS7, L929, NRK , BHK and MDBK cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituents: 50% PBS, 50% Glycerol

    Filter-sterilized
  • Concentration information loading...
  • Purification notes

    ab180657 was purified from the serum-free cultured medium of the hybridoma under mild conditions by proprietary chromatography processes.
  • Clonality

    Monoclonal
  • Clone number

    3D10
  • Isotype

    IgG2a
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab180657 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 58 kDa.
ELISA Use at an assay dependent concentration.
  • Application notes
    Is unsuitable for IHC or IP.
  • Target

    • Function

      Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non-classical NLS. In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non-classical NLS.
    • Tissue specificity

      Highly expressed in testis, ovary, small intestine, heart, skeletal muscle, lung and pancreas, but barely detectable in kidney, thymus, colon and peripheral blood leukocytes.
    • Sequence similarities

      Belongs to the importin alpha family.
      Contains 10 ARM repeats.
      Contains 1 IBB domain.
    • Domain

      Consists of an N-terminal hydrophilic region, a hydrophobic central region composed of 10 repeats, and a short hydrophilic C-terminus. The N-terminal hydrophilic region contains the importin beta binding domain (IBB domain), which is sufficient for binding importin beta and essential for nuclear protein import.
      The IBB domain is thought to act as an intrasteric autoregulatory sequence by interacting with the internal autoinhibitory NLS. Binding of KPNB1 probably overlaps the internal NLS and contributes to a high affinity for cytoplasmic NLS-containing cargo substrates. After dissociation of the importin/substrate complex in the nucleus the internal autohibitory NLS contributes to a low affinity for nuclear NLS-containing proteins.
      The major and minor NLS binding sites are mainly involved in recognition of simple or bipartite NLS motifs. Structurally located within in a helical surface groove they contain several conserved Trp and Asn residues of the corresponding third helices (H3) of ARM repeats which mainly contribute to binding.
    • Cellular localization

      Cytoplasm. Nucleus.
    • Information by UniProt
    • Database links

    • Alternative names

      • FLJ31113 antibody
      • IMA3_HUMAN antibody
      • Importin alpha 3 antibody
      • Importin alpha 4 subunit antibody
      • Importin alpha Q1 antibody
      • Importin subunit alpha 3 antibody
      • Importin subunit alpha-3 antibody
      • IPO A3 antibody
      • IPOA 3 antibody
      • IPOA3 antibody
      • Karyopherin alpha 4 (importin alpha 3) antibody
      • Karyopherin alpha 4 antibody
      • Karyopherin alpha 4 importin alpha 3 antibody
      • Karyopherin alpha 4 subunit antibody
      • Karyopherin subunit alpha 4 antibody
      • Karyopherin subunit alpha-4 antibody
      • KPNA 4 antibody
      • Kpna4 antibody
      • MGC12217 antibody
      • MGC26703 antibody
      • OTTHUMP00000213880 antibody
      • QIP 1 antibody
      • Qip1 antibody
      • Qip1 protein antibody
      • SRP 3 antibody
      • SRP3 antibody
      see all

    Images

    • All lanes : Anti-KPNA4 antibody [3D10] (ab180657) at 1/250 dilution

      Lane 1 : HeLa whole cell extract
      Lane 2 : COS7 whole cell extract
      Lane 3 : L929 whole cell extract
      Lane 4 : NRK whole cell extract
      Lane 5 : BHK whole cell extract
      Lane 6 : MDBK whole cell extract

      Predicted band size: 58 kDa

    References

    ab180657 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab180657.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up