For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    kpna4-antibody-ab176585.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Protein Trafficking Nuclear Import / Export
Share by email

Anti-KPNA4 antibody (ab176585)

  • Datasheet
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-KPNA4 antibody (ab176585)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-KPNA4 antibody (ab176585)
  • Immunoprecipitation - Anti-KPNA4 antibody (ab176585)

Key features and details

  • Rabbit polyclonal to KPNA4
  • Suitable for: WB, IP, IHC-P
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Protein
Product image
Recombinant Human KPNA4 protein (ab114626)
Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-KPNA4 antibody
    See all KPNA4 primary antibodies
  • Description

    Rabbit polyclonal to KPNA4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rabbit, Horse, Cow, Dog, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan
  • Immunogen

    Synthetic peptide within Human KPNA4 aa 471-521 (C terminal). The exact sequence is proprietary. (NP_002259.1).
    Sequence:

    EDIYKLAYEIIDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQ F


    Database link: O00629
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • HeLa and 293T whole cell lysates; Human Ovarian Carcinoma and Prostate Carcinoma tissues.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 6.8
    Preservative: 0.09% Sodium azide
    Constituents: 99% Tris buffered saline, 0.1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab176585 was affinity purified using an epitope specific to KPNA4 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Protein Trafficking
    • Nuclear Import / Export

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Positive Controls

    • HeLa whole cell lysate (ab150035)
    • HeLa whole cell lysate (ab29545)
  • Recombinant Protein

    • Recombinant Human KPNA4 protein (ab114626)
  • Related Products

    • Recombinant Human KPNA4 protein (ab114626)

Applications

Our Abpromise guarantee covers the use of ab176585 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 57 kDa.
IP Use at 2-5 µg/mg of lysate.
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non-classical NLS. In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non-classical NLS.
  • Tissue specificity

    Highly expressed in testis, ovary, small intestine, heart, skeletal muscle, lung and pancreas, but barely detectable in kidney, thymus, colon and peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the importin alpha family.
    Contains 10 ARM repeats.
    Contains 1 IBB domain.
  • Domain

    Consists of an N-terminal hydrophilic region, a hydrophobic central region composed of 10 repeats, and a short hydrophilic C-terminus. The N-terminal hydrophilic region contains the importin beta binding domain (IBB domain), which is sufficient for binding importin beta and essential for nuclear protein import.
    The IBB domain is thought to act as an intrasteric autoregulatory sequence by interacting with the internal autoinhibitory NLS. Binding of KPNB1 probably overlaps the internal NLS and contributes to a high affinity for cytoplasmic NLS-containing cargo substrates. After dissociation of the importin/substrate complex in the nucleus the internal autohibitory NLS contributes to a low affinity for nuclear NLS-containing proteins.
    The major and minor NLS binding sites are mainly involved in recognition of simple or bipartite NLS motifs. Structurally located within in a helical surface groove they contain several conserved Trp and Asn residues of the corresponding third helices (H3) of ARM repeats which mainly contribute to binding.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Target information above from: UniProt accession O00629 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 470982 Chimpanzee
    • Entrez Gene: 100757318 Chinese hamster
    • Entrez Gene: 535090 Cow
    • Entrez Gene: 478680 Dog
    • Entrez Gene: 3840 Human
    • Entrez Gene: 100171548 Orangutan
    • Entrez Gene: 100349259 Rabbit
    • Entrez Gene: 702486 Rhesus monkey
    • Omim: 602970 Human
    • SwissProt: O00629 Human
    • Unigene: 467866 Human
    see all
  • Alternative names

    • FLJ31113 antibody
    • IMA3_HUMAN antibody
    • Importin alpha 3 antibody
    • Importin alpha 4 subunit antibody
    • Importin alpha Q1 antibody
    • Importin subunit alpha 3 antibody
    • Importin subunit alpha-3 antibody
    • IPO A3 antibody
    • IPOA 3 antibody
    • IPOA3 antibody
    • Karyopherin alpha 4 (importin alpha 3) antibody
    • Karyopherin alpha 4 antibody
    • Karyopherin alpha 4 importin alpha 3 antibody
    • Karyopherin alpha 4 subunit antibody
    • Karyopherin subunit alpha 4 antibody
    • Karyopherin subunit alpha-4 antibody
    • KPNA 4 antibody
    • Kpna4 antibody
    • MGC12217 antibody
    • MGC26703 antibody
    • OTTHUMP00000213880 antibody
    • QIP 1 antibody
    • Qip1 antibody
    • Qip1 protein antibody
    • SRP 3 antibody
    • SRP3 antibody
    see all

Images

  • Western blot - Anti-KPNA4 antibody (ab176585)
    Western blot - Anti-KPNA4 antibody (ab176585)
    All lanes : Anti-KPNA4 antibody (ab176585) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 5 µg
    Lane 4 : 293T whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 57 kDa


    Exposure time: 3 seconds
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-KPNA4 antibody (ab176585)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-KPNA4 antibody (ab176585)

    Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human prostate carcinoma tissue labeling KPNA4  with ab176585 at 1µg/ml.

  • Immunoprecipitation - Anti-KPNA4 antibody (ab176585)
    Immunoprecipitation - Anti-KPNA4 antibody (ab176585)

    Detection of KPNA4 in Immunoprecipitates of Jurkat whole cell lysate (1 mg for IP, 20% of IP loaded) using ab176585 at 3 µg/mg lysate for IP (Lane 1). For WB detection ab176585 was used at 0.4 µg/ml. Lane 2 represents control IgG IP.

    Detection: Chemiluminescence with an exposure time of 0.5 seconds.

Protocols

  • Immunoprecipitation protocols
  • Immunohistochemistry protocols
  • Immunocytochemistry & immunofluorescence protocols
  • Western blot protocols

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (1)

    Publishing research using ab176585? Please let us know so that we can cite the reference in this datasheet.

    ab176585 has been referenced in 1 publication.

    • Sun B  et al. Citrullination of NF-?B p65 promotes its nuclear localization and TLR-induced expression of IL-1ß and TNFa. Sci Immunol 2:N/A (2017). PubMed: 28783661

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab176585.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.