Overview

  • Product name

  • Description

    Rabbit polyclonal to KRAP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Sheep, Rabbit, Cat, Dog, Chimpanzee, Macaque monkey, Rhesus monkey, Gorilla, Common marmoset, Orangutan
  • Immunogen

    Synthetic peptide within Human KRAP aa 1209-1259. The exact sequence is proprietary. NP_001123917.1.
    Sequence:

    MDRPLSSSAEAEEELEWQVASRRRKAWAKCRSSWQASETEDLSTEATTQD


    Database link: P28290

  • Positive control

    • HeLa and 293T whole cell lysates.
  • General notes

    Previously labelled as SSFA2. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab195334 was affinity purified using an epitope specific to KRAP immobilized on a solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab195334 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.

Target

Images

  • Immunoprecipitation of 293T whole cell lysate in NETN lysis buffer using ab195334 (lane 1) at 6 µg/mg lysate (0.5 or 1 mg/IP; 20% of IP loaded/lane). Immunoblot analysis of KRAP utilized ab195334 at 1 µg/mL. The lysate in lane 2 is precipitated with an IgG control antibody. Detection utilized chemiluminescence with an exposure time of 3 minutes.

References

ab195334 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab195334.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up