Anti-KRAP antibody (ab195334)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-KRAP antibody
See all KRAP primary antibodies -
Description
Rabbit polyclonal to KRAP -
Host species
Rabbit -
Tested applications
Suitable for: IPmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Sheep, Rabbit, Cat, Dog, Chimpanzee, Macaque monkey, Rhesus monkey, Gorilla, Common marmoset, Orangutan -
Immunogen
Synthetic peptide within Human KRAP aa 1209-1259. The exact sequence is proprietary. NP_001123917.1.
Sequence:MDRPLSSSAEAEEELEWQVASRRRKAWAKCRSSWQASETEDLSTEATTQD
Database link: P28290 -
Positive control
- HeLa and 293T whole cell lysates.
-
General notes
Previously labelled as SSFA2.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7-8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab195334 was affinity purified using an epitope specific to KRAP immobilized on a solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab195334 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IP | Use at 2-10 µg/mg of lysate. |
Target
- Information by UniProt
-
Database links
- Entrez Gene: 101082254 Cat
- Entrez Gene: 459795 Chimpanzee
- Entrez Gene: 100415594 Common marmoset
- Entrez Gene: 478824 Dog
- Entrez Gene: 101137903 Gorilla
- Entrez Gene: 6744 Human
- Entrez Gene: 102130099 Macaque monkey
- Entrez Gene: 100171627 Orangutan
see all -
Alternative names
- Cleavage signal-1 protein antibody
- CS-1 antibody
- CS1 antibody
see all
Images
-
Immunoprecipitation of 293T whole cell lysate in NETN lysis buffer using ab195334 (lane 1) at 6 µg/mg lysate (0.5 or 1 mg/IP; 20% of IP loaded/lane). Immunoblot analysis of KRAP utilized ab195334 at 1 µg/mL. The lysate in lane 2 is precipitated with an IgG control antibody. Detection utilized chemiluminescence with an exposure time of 3 minutes.
Protocols
Datasheets and documents
References
ab195334 has not yet been referenced specifically in any publications.