Anti-KRAP antibody (ab195334)
Key features and details
- Rabbit polyclonal to KRAP
- Suitable for: IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-KRAP antibody
See all KRAP primary antibodies -
Description
Rabbit polyclonal to KRAP -
Host species
Rabbit -
Tested applications
Suitable for: IPmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Sheep, Rabbit, Cat, Dog, Chimpanzee, Macaque monkey, Rhesus monkey, Gorilla, Common marmoset, Orangutan
-
Immunogen
Synthetic peptide within Human KRAP aa 1209-1259. The exact sequence is proprietary. NP_001123917.1.
Sequence:MDRPLSSSAEAEEELEWQVASRRRKAWAKCRSSWQASETEDLSTEATTQD
Database link: P28290 -
Positive control
- HeLa and 293T whole cell lysates.
-
General notes
Previously labelled as SSFA2.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7-8 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab195334 was affinity purified using an epitope specific to KRAP immobilized on a solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab195334 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IP | Use at 2-10 µg/mg of lysate. |
Target
- Information by UniProt
-
Database links
- Entrez Gene: 101082254 Cat
- Entrez Gene: 459795 Chimpanzee
- Entrez Gene: 100415594 Common marmoset
- Entrez Gene: 478824 Dog
- Entrez Gene: 101137903 Gorilla
- Entrez Gene: 6744 Human
- Entrez Gene: 102130099 Macaque monkey
- Entrez Gene: 100171627 Orangutan
see all -
Alternative names
- Cleavage signal-1 protein antibody
- CS-1 antibody
- CS1 antibody
see all
Images
-
Immunoprecipitation - Anti-KRAP antibody (ab195334)Immunoprecipitation of 293T whole cell lysate in NETN lysis buffer using ab195334 (lane 1) at 6 µg/mg lysate (0.5 or 1 mg/IP; 20% of IP loaded/lane). Immunoblot analysis of KRAP utilized ab195334 at 1 µg/mL. The lysate in lane 2 is precipitated with an IgG control antibody. Detection utilized chemiluminescence with an exposure time of 3 minutes.
Datasheets and documents
References (0)
ab195334 has not yet been referenced specifically in any publications.
