Overview

  • Product name

    Anti-KRT35 antibody
  • Description

    Rabbit polyclonal to KRT35
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human KRT35 aa 1-455.
    Sequence:

    MASKCLKAGFSSGSLKSPGGASGGSTRVSAMYSSSSCKLPSLSPVARSFS ACSVGLGRSSYRATSCLPALCLPAGGFATSYSGGGGWFGEGILTGNEKET MQSLNDRLAGYLEKVRQLEQENASLESRIREWCEQQVPYMCPDYQSYFRT IEELQKKTLCSKAENARLVVEIDNAKLAADDFRTKYETEVSLRQLVESDI NGLRRILDDLTLCKSDLEAQVESLKEELLCLKKNHEEEVNSLRCQLGDRL NVEVDAAPPVDLNRVLEEMRCQYETLVENNRRDAEDWLDTQSEELNQQVV SSSEQLQSCQAEIIELRRTVNALEIELQAQHSMRDALESTLAETEARYSS QLAQMQCMITNVEAQLAEIRADLERQNQEYQVLLDVRARLECEINTYRGL LESEDSKLPCNPCAPDYSPSKSCLPCLPAASCGPSAARTNCSPRPICVPC PGGRF


    Database link: Q92764

  • Positive control

    • WB: PC-3 whole cell lysate. IHC-P: Human skin and prostate cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235356 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000.
IHC-P 1/20 - 1/200.

Target

Images

  • Anti-KRT35 antibody (ab235356) at 1/500 dilution + PC-3 (human prostate adenocarcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human skin tissue stained for KRT35 using ab235356 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate cancer tissue stained for KRT35 using ab235356 at 1/100 dilution in immunohistochemical analysis.

References

ab235356 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235356.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up