Overview

  • Product name
  • Description
    Mouse polyclonal to KSR2
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human KSR2 aa 122-950.
    Sequence:

    MTDEQVCETVEKYGANREECARLNASLSCLRNVHMSGGNLSKQDWTIQWP TTETGKENNPVCPPEPTPWIRTHLSQSPRVPSKCVQHYCHTSPTPGAPVY THVDRLTVDAYPGLCPPPPLESGHRSLPPSPRQRHAVRTPPRTPNIVTTV TPPGTPPMRKKNKLKPPGTPPPSSRKLIHLIPGFTALHRSKSHEFQLGHR VDEAHTPKAKKKSKPLNLKIHSSVGSCENIPSQQRSPLLSERSLRSFFVG HAPFLPSTPPVHTEANFSANTLSVPRWSPQIPRRDLGNSIKHRFSTKYWM SQTCTVCGKGMLFGLKCKNCKLKCHNKCTKEAPPCHLLIIHRGDPARLVR TESVPCDINNPLRKPPRYSDLHISQTLPKTNKINKDHIPVPYQPDSSSNP SSTTSSTPSSPAPPLPPSATPPSPLHPSPQCTRQQKNFNLPASHYYKYKQ QFIFPDVVPVPETPTRAPQVILHPVTSNPILEGNPLLQIEVEPTSENEEV HDEAEESEDDFEEMNLSLLSARSFPRKASQTSIFLQEWDIPFEQLEIGEL IGKGRFGQVYHGRWHGEVAIRLIDIERDNEDQLKAFKREVMAYRQTRHEN VVLFMGACMSPPHLAIITSLCKGRTLYSVVRDAKIVLDVNKTRQIAQEIV KGMGYLHAKGILHKDLKSKNVFYDNGKVVITDFGLFSISGVLQAGRREDK LRIQNGWLCHLAPEIIRQLSPDTEEDKLPFSKHSDVFALGTIWYELHARE WPFKTQPAEAIIWQMGTGMKPNLSQIGMGKEISDILLFCWAFEQEERPTF TKLMDMLEKLPKRNRRLSHPGHFWKSAEL


    Database link: Q6VAB6-1

  • Positive control
    • KSR2-transfected 293T cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab173377 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 108 kDa.

Target

  • Function
    Location-regulated scaffold connecting MEK to RAF. Blocks MAP3K8 kinase activity and MAP3K8-mediated signaling. Acts as a negative regulator of MAP3K3-mediated activation of ERK, JNK and NF-kappa-B pathways, inhibiting MAP3K3-mediated interleukin-8 production.
  • Tissue specificity
    Mainly expressed in brain and kidney.
  • Sequence similarities
    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.
    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 protein kinase domain.
  • Domain
    The protein kinase domain is predicted to be catalytically inactive.
  • Post-translational
    modifications
    Phosphorylated on Ser-474 by MARK3.
  • Cellular localization
    Cytoplasm. Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ25965 antibody
    • hKSR 2 antibody
    • hKSR2 antibody
    • Kinase suppressor of Ras 2 antibody
    • KSR 2 antibody
    • Ksr2 antibody
    • KSR2_HUMAN antibody
    see all

Images

  • All lanes : Anti-KSR2 antibody (ab173377) at 1 µg/ml

    Lane 1 : KSR2-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 108 kDa

References

ab173377 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173377.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up