Overview

  • Product name

    Anti-Kv beta 1/KCNAB1 antibody
    See all Kv beta 1/KCNAB1 primary antibodies
  • Description

    Rabbit polyclonal to Kv beta 1/KCNAB1
  • Host species

    Rabbit
  • Specificity

    ab28674 recognises Voltage-gated potassium channel beta-1 subunit (KCNAB1)
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Pig
  • Immunogen

    Synthetic peptide within Human Kv beta 1/KCNAB1 aa 311-360 (C terminal). The exact sequence is proprietary.
    Sequence:

    VPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAV


    Database link: Q14722

  • Positive control

    • Human Fetal Kidney Lysate
  • General notes

     This product was previously labelled as Kv beta 1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab28674 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 46 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

References

ab28674 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab28674.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up