Overview

  • Product name

    Anti-Kv4.2/KCND2 antibody [5B11B9]
    See all Kv4.2/KCND2 primary antibodies
  • Description

    Mouse monoclonal [5B11B9] to Kv4.2/KCND2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit
  • Immunogen

    Recombinant fragment corresponding to Human Kv4.2/KCND2 aa 27-184. (Purified from E.coli).
    Sequence:

    MPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLERYPDTLLGSSERDFFY HPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELAFFGLIP EIIGDCCYEEYKDRRRENAERLQDDADTDTAGESALPTMTARQRVWRAFE NPHTSTMA


    Database link: Q9NZV8

  • Positive control

    • Recombinant Human Kv4.2/KCND2 (aa27-184) protein; Kv4.2/KCND2 (aa27-184)-hIgGFc transfected HEK293 cell lysate; HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    5B11B9
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204942 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 71 kDa.
Flow Cyt 1/200 - 1/400.

Target

  • Function

    Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I(To) current in heart and I(Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits.
  • Tissue specificity

    Highly expressed throughout the brain. Expression is very low or absent in other tissues.
  • Sequence similarities

    Belongs to the potassium channel family. D (Shal) (TC 1.A.1.2) subfamily. Kv4.2/KCND2 sub-subfamily.
  • Domain

    The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
  • Post-translational
    modifications

    Phosphorylated on serine and threonine residues.
  • Cellular localization

    Cell membrane. Cell projection > dendrite. Detected in dendrites in cultured hippocampal neurons. Association with KCNIP2 probably enhances cell surface expression.
  • Information by UniProt
  • Database links

  • Alternative names

    • KCD2 antibody
    • KCND 2 antibody
    • KCND2 antibody
    • KCND2_HUMAN antibody
    • KIAA1044 antibody
    • MGC119702 antibody
    • MGC119703 antibody
    • Potassium voltage gated channel Shal related subfamily member 2 antibody
    • Potassium voltage-gated channel subfamily D member 2 antibody
    • RK 5 antibody
    • RK5 antibody
    • Voltage gated potassium channel Kv4.2 antibody
    • Voltage gated potassium channel subunit Kv4.2 antibody
    • Voltage sensitive potassium channel antibody
    • Voltage-gated potassium channel subunit Kv4.2 antibody
    see all

Images

  • Anti-Kv4.2/KCND2 antibody [5B11B9] (ab204942) at 1/500 dilution + Recombinant Human Kv4.2/KCND2 (aa27-184) protein

    Predicted band size: 71 kDa



    Expected MWt is 42.3 kDa.

  • All lanes : Anti-Kv4.2/KCND2 antibody [5B11B9] (ab204942) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : Kv4.2/KCND2 (aa27-184)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 71 kDa

  • Flow cytometric analysis of HeLa cells labeling Kv4.2/KCND2 with ab204942 at 1/200 dilution (green), compared to a negative control (red).

References

ab204942 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204942.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up