Overview

  • Product name
  • Description
    Rabbit polyclonal to Kv4.3
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ELISA, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Pig
  • Immunogen

    Synthetic peptide within Human Kv4.3 aa 424-473 (internal sequence). The exact sequence is proprietary.
    Sequence:

    KARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIE


    Database link: Q9UK17

  • Positive control
    • HepG2 lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab49348 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:12500.

WB Use a concentration of 1.25 µg/ml. Detects a band of approximately 61, 42 kDa (predicted molecular weight: 70 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I(To) current in heart and I(Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits.
  • Tissue specificity
    Highly expressed in heart and brain, in particular in cortex, cerebellum, amygdala and caudate nucleus. Detected at lower levels in liver, skeletal muscle, kidney and pancreas. Isoform 1 predominates in most tissues. Isoform 1 and isoform 2 are detected at similar levels in brain, skeletal muscle and pancreas.
  • Sequence similarities
    Belongs to the potassium channel family. D (Shal) (TC 1.A.1.2) subfamily. Kv4.3/KCND3 sub-subfamily.
  • Domain
    The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
  • Cellular localization
    Membrane. Cell membrane > sarcolemma.
  • Information by UniProt
  • Database links
  • Alternative names
    • KCND 3 antibody
    • KCND 3L antibody
    • KCND 3S antibody
    • Kcnd3 antibody
    • KCND3_HUMAN antibody
    • KCND3L antibody
    • KCND3S antibody
    • KSHIVB antibody
    • Kv 4.3 antibody
    • MGC14203 antibody
    • MGC142037 antibody
    • OTTHUMP00000063948 antibody
    • Potassium ioinic channel Kv4.3 antibody
    • Potassium voltage gated channel Shal related subfamily member 3 antibody
    • Potassium voltage gated channel subfamily D member 3 antibody
    • Potassium voltage-gated channel subfamily D member 3 antibody
    • Sha1 related potassium channel Kv4.3 antibody
    • Voltage gated K+ channel antibody
    • Voltage gated potassium channel Kv4.3 antibody
    • Voltage gated potassium channel subunit Kv4.3 antibody
    • Voltage-gated potassium channel subunit Kv4.3 antibody
    see all

Images

  • Anti-Kv4.3 antibody (ab49348) at 1.25 µg/ml + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG 1/50,000 -1/100,000

    Predicted band size: 70 kDa
    Observed band size: 60,61 kDa
    why is the actual band size different from the predicted?
    Additional bands at: 42 kDa (possible non-specific binding)

References

ab49348 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Thank you for contacting Abcam. I am sorry to hear that ab65794 has not been working for you. I will be glad to help you find an alternative antibody. To help determine the antibody that will best suit your needs, could you tell me what tissue/species you are working in. Also is there any application that you are primarily interested in eg WB, IHC-P, IP, ICC. I look forward to hearing back from you and helping to find an antibody for you.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up