Overview

  • Product name

    Anti-kynurenine 3-monooxygenase antibody
    See all kynurenine 3-monooxygenase primary antibodies
  • Description

    Rabbit polyclonal to kynurenine 3-monooxygenase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Pig
  • Immunogen

    Recombinant fragment corresponding to Human kynurenine 3-monooxygenase aa 224-309.
    Sequence:

    IALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLL VQDFFLLPAQPMISVKCSSFHFKSHCVLLGDAAHAI


    Database link: O15229

  • Positive control

    • Human kidney tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab220922 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Catalyzes the hydroxylation of L-kynurenine (L-Kyn) to form 3-hydroxy-L-kynurenine (L-3OHKyn). Required for synthesis of quinolinic acid, a neurotoxic NMDA receptor antagonist and potential endogenous inhibitor of NMDA receptor signaling in axonal targeting, synaptogenesis and apoptosis during brain development. Quinolinic acid may also affect NMDA receptor signaling in pancreatic beta cells, osteoblasts, myocardial cells, and the gastrointestinal tract.
  • Tissue specificity

    Highest levels in placenta and liver. Detectable in kidney.
  • Pathway

    Cofactor biosynthesis; NAD(+) biosynthesis; quinolinate from L-kynurenine: step 1/3.
  • Sequence similarities

    Belongs to the aromatic-ring hydroxylase family. KMO subfamily.
  • Cellular localization

    Mitochondrion outer membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • dJ317G22.1 antibody
    • kmo antibody
    • KMO_HUMAN antibody
    • Kynurenine 3 hydroxylase antibody
    • Kynurenine 3 monooxygenase (kynurenine 3 hydroxylase) antibody
    • Kynurenine 3 monooxygenase antibody
    • Kynurenine 3-hydroxylase antibody
    • Kynurenine 3-monooxygenase antibody
    • RP1-317G22.1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin fixed, paraffin-embedded Human kidney tissue labeling kynurenine 3-monooxygenase with ab220922 at 1/200 dilution.

References

ab220922 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220922.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up