Overview

  • Product name

    Anti-kynurenine 3-monooxygenase antibody
    See all kynurenine 3-monooxygenase primary antibodies
  • Description

    Rabbit polyclonal to kynurenine 3-monooxygenase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human kynurenine 3-monooxygenase aa 1-282. Two N-terminal tags. Expressed in E.coli.
    Sequence:

    MASSDTEGKRVVVIGGGLVGALNACFLAKRNFQVDVYEAREDIRVANFMR GRSINLALSYRGRQALKAVGLEDQIVSKGVPMKARMIHSLSGKKSAIPYG NKSQYILSISREKLNKDLLTAVESYPNAKVHFGHKLSKCCPEEGILTMLG PNKVPRDITCDLIVGCDGAYSTVRAHLMKKPRFDYSQQYIPHGYMELTIP PKNGEYAMEPNCLHIWPRNAFMMIALPNMDKSFTCTLFMSFEEFEKLPTH SDVLDFFQKNFPDAIPLMGEQALMRDFFLLPA


    Database link: O88867

  • Positive control

    • WB: Recombinant rat kynurenine 3-monoxygenase; Rat kidney, spleen, liver and heart tissue lysate. IHC-P: Rat liver, skin and heart tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233529 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 54 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Catalyzes the hydroxylation of L-kynurenine (L-Kyn) to form 3-hydroxy-L-kynurenine (L-3OHKyn). Required for synthesis of quinolinic acid, a neurotoxic NMDA receptor antagonist and potential endogenous inhibitor of NMDA receptor signaling in axonal targeting, synaptogenesis and apoptosis during brain development. Quinolinic acid may also affect NMDA receptor signaling in pancreatic beta cells, osteoblasts, myocardial cells, and the gastrointestinal tract.
  • Tissue specificity

    Highest levels in placenta and liver. Detectable in kidney.
  • Pathway

    Cofactor biosynthesis; NAD(+) biosynthesis; quinolinate from L-kynurenine: step 1/3.
  • Sequence similarities

    Belongs to the aromatic-ring hydroxylase family. KMO subfamily.
  • Cellular localization

    Mitochondrion outer membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • dJ317G22.1 antibody
    • kmo antibody
    • KMO_HUMAN antibody
    • Kynurenine 3 hydroxylase antibody
    • Kynurenine 3 monooxygenase (kynurenine 3 hydroxylase) antibody
    • Kynurenine 3 monooxygenase antibody
    • Kynurenine 3-hydroxylase antibody
    • Kynurenine 3-monooxygenase antibody
    • RP1-317G22.1 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for kynurenine 3-monooxygenase using ab233529 at 20μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat skin tissue stained for kynurenine 3-monooxygenase using ab233529 at 20μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat heart tissue stained for kynurenine 3-monooxygenase using ab233529 at 20μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-kynurenine 3-monooxygenase antibody (ab233529) at 1 µg/ml + Recombinant kynurenine 3-monooxygenase protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Developed using the ECL technique.

    Predicted band size: 54 kDa

  • All lanes : Anti-kynurenine 3-monooxygenase antibody (ab233529) at 1 µg/ml

    Lane 1 : Rat kidney tissue lysate
    Lane 2 : Rat spleen tissue lysate
    Lane 3 : Rat liver tissue lysate
    Lane 4 : Rat heart tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Developed using the ECL technique.

    Predicted band size: 54 kDa

References

ab233529 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233529.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up