Overview

  • Product name

    Anti-L-Kynurenine Hydrolase antibody
    See all L-Kynurenine Hydrolase primary antibodies
  • Description

    Rabbit polyclonal to L-Kynurenine Hydrolase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human L-Kynurenine Hydrolase aa 99-214.
    Sequence:

    AYGHEVGKRPWITGDESIVGLMKDIVGANEKEIALMNALTVNLHLLMLSF FKPTPKRYKILLEAKAFPSDHYAIESQLQLHGLNIEESMRMIKPREGEET LRIEDILEVIEKEGDS


    Database link: Q16719

  • Positive control

    • WB: Mouse spleen lysate. IHC-P: Human heart tissue. ICC/IF: MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236980 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 52 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Catalyzes the cleavage of L-kynurenine (L-Kyn) and L-3-hydroxykynurenine (L-3OHKyn) into anthranilic acid (AA) and 3-hydroxyanthranilic acid (3-OHAA), respectively. Has a preference for the L-3-hydroxy form. Also has cysteine-conjugate-beta-lyase activity.
  • Tissue specificity

    Expressed in all tissues tested (heart, brain placenta, lung, liver, skeletal muscle, kidney and pancreas). Highest levels found in placenta, liver and lung. Expressed in all brain regions.
  • Pathway

    Amino-acid degradation; L-kynurenine degradation; L-alanine and anthranilate from L-kynurenine: step 1/1.
    Cofactor biosynthesis; NAD(+) biosynthesis; quinolinate from L-kynurenine: step 2/3.
  • Involvement in disease

    Note=Xanthurenic aciduria manifesting as massive urinary excretion of large amounts of kynurenine, 3-hydroxykynurenine and xanthurenic acid has been observed in an individual carrying a homozygous missense change in KYNU (PubMed:17334708). The urinary pattern in the patient suggests kynureninase deficiency and a block in the conversion of kynurenine and 3-hydroxykynurenine to anthranilate and 3-hydroxyanthranilate, respectively.
  • Sequence similarities

    Belongs to the kynureninase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • kynU antibody
    • KYNU_HUMAN antibody
    • kynureninase (L-kynurenine hydrolase) antibody
    • Kynureninase antibody
    • L-kynurenine hydrolase antibody
    see all

Images

  • Anti-L-Kynurenine Hydrolase antibody (ab236980) at 1/1000 dilution + Mouse spleen lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 52 kDa

  • Paraffin-embedded human heart tissue stained for L-Kynurenine Hydrolase using ab236980 at 1/100 dilution in immunohistochemical analysis.

  • MCF7 (human breast adenocarcinoma cell line) cells stained for L-Kynurenine Hydrolase (green) using ab236980 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236980 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236980.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up