Overview

  • Product name

  • Description

    Rabbit polyclonal to L12
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human L12 aa 150-200 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    SSFDFFLTDARIRRLLPSLIGRHFYQRKKVPVSVNLLSKNLSREINDCIG G


    Database link: O76021

  • Positive control

    • Rat brain lysate; Human placenta tissue.
  • General notes

     This product was previously labelled as RSL1D1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab202978 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 55 kDa.
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 if using a fluorescent secondary antibody).

Target

Images

  • All lanes : Anti-L12 antibody (ab202978) at 1/200 dilution

    Lane 1 : Rat brain lysate
    Lane 2 : Rat kidney lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/3000 dilution

    Predicted band size: 55 kDa
    Observed band size: 54 kDa
    why is the actual band size different from the predicted?



    12% SDS-PAGE

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human placenta tissue labeling L12 with ab202978 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab202978 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202978.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up