Overview

  • Product name

  • Description

    Rabbit polyclonal to L1CAM
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human L1CAM aa 526-690. (Expressed in E.coli).
    Sequence:

    STIEKKGSRVTFTCQASFDPSLQPSITWRGDGRDLQELGDSDKYFIEDGR LVIHSLDYSDQGNYSCVASTELDVVESRAQLLVVGSPGPVPRLVLSDLHL LTQSQVRVSWSPAEDHNAPIEKYDIEFEDKEMAPEKWYSLGKVPGNQTST TLKLSPYVHYTFRVT


    Database link: P32004

  • Positive control

    • IHC-P: Human kidney tissue. WB: Pig cerebrum and kidney lysates; Recombinant human L1CAM protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab232894 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 140 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Cell adhesion molecule with an important role in the development of the nervous system. Involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc. Binds to axonin on neurons.
  • Involvement in disease

    Defects in L1CAM are the cause of hydrocephalus due to stenosis of the aqueduct of Sylvius (HSAS) [MIM:307000]. Hydrocephalus is a condition in which abnormal accumulation of cerebrospinal fluid in the brain causes increased intracranial pressure inside the skull. This is usually due to blockage of cerebrospinal fluid outflow in the brain ventricles or in the subarachnoid space at the base of the brain. In children is typically characterized by enlargement of the head, prominence of the forehead, brain atrophy, mental deterioration, and convulsions. In adults the syndrome includes incontinence, imbalance, and dementia. HSAS is characterized by mental retardation and enlarged brain ventricles.
    Defects in L1CAM are the cause of mental retardation-aphasia-shuffling gait-adducted thumbs syndrome (MASA) [MIM:303350]; also known as corpus callosum hypoplasia, psychomotor retardation, adducted thumbs, spastic paraparesis, and hydrocephalus or CRASH syndrome. MASA is an X-linked recessive syndrome with a highly variable clinical spectrum. Main clinical features include spasticity and hyperreflexia of lower limbs, shuffling gait, mental retardation, aphasia and adducted thumbs. The features of spasticity have been referred to as complicated spastic paraplegia type 1 (SPG1). Some patients manifest corpus callosum hypoplasia and hydrocephalus. Inter- and intrafamilial variability is very wide, such that patients with hydrocephalus, MASA, SPG1, and agenesis of corpus callosum can be present within the same family.
    Defects in L1CAM are the cause of spastic paraplegia X-linked type 1 (SPG1) [MIM:303350]. Spastic paraplegia is a degenerative spinal cord disorder characterized by a slow, gradual, progressive weakness and spasticity of the lower limbs.
    Note=Defects in L1CAM may contribute to Hirschsprung disease by modifying the effects of Hirschsprung disease-associated genes to cause intestinal aganglionosis.
    Defects in L1CAM are a cause of partial agenesis of the corpus callosum (ACCPX) [MIM:304100]. A syndrome characterized by partial corpus callosum agenesis, hypoplasia of inferior vermis and cerebellum, mental retardation, seizures and spasticity. Other features include microcephaly, unusual facies, and Hirschsprung disease in some patients.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. L1/neurofascin/NgCAM family.
    Contains 5 fibronectin type-III domains.
    Contains 6 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Antigen identified by monoclonal antibody R1 antibody
    • CAML1 antibody
    • CD171 antibody
    • CD171 antigen antibody
    • HSAS antibody
    • HSAS1 antibody
    • Hyd antibody
    • L1 antibody
    • L1 cell adhesion molecule antibody
    • L1-NCAM antibody
    • L1cam antibody
    • L1CAM_HUMAN antibody
    • MASA antibody
    • MIC5 antibody
    • N CAML1 antibody
    • N-CAM-L1 antibody
    • NCAM-L1 antibody
    • NCAML1 antibody
    • Nerve-growth factor-inducible large external glycoprotein antibody
    • Neural cell adhesion molecule L1 antibody
    • NILE antibody
    • OTTHUMP00000025992 antibody
    • S10 antibody
    • SPG1 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for L1CAM using ab232894 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-L1CAM antibody (ab232894) at 2 µg/ml + Pig kidney lysate

    Predicted band size: 140 kDa

  • Anti-L1CAM antibody (ab232894) at 2 µg/ml + Pig cerebrum lysate

    Predicted band size: 140 kDa

References

ab232894 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232894.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up