Anti-L2HGDH antibody (ab230194)
Key features and details
- Rabbit polyclonal to L2HGDH
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-L2HGDH antibody
See all L2HGDH primary antibodies -
Description
Rabbit polyclonal to L2HGDH -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Orangutan
-
Immunogen
Recombinant fragment corresponding to Human L2HGDH aa 1-120.
Sequence:MVPALRYLVGACGRARGLFAGGSPGACGFASGRPRPLCGGSRSASTSSFD IVIVGGGIVGLASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSG IYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVAVEQEEIPRLQ ALYEKGLQNGVPGLRLIQQEDIKKKEPYCRGLMAIDCPHTGIVDYRQVAL SFAQDFQEAGGSVLTNFEVK
Database link: Q9H9P8 -
Positive control
- IHC-P: Human testis tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab230194 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/200. |
Target
-
Tissue specificity
Widely expressed. Highly expressed in brain, testis and muscle. Expressed to a lower extent in lymphocytes, fibroblasts, keratinocytes, placenta, bladder, small intestine, liver and bone marrow. -
Involvement in disease
Defects in L2HGDH are the cause of L-2-hydroxyglutaric aciduria (L2HGA) [MIM:236792]. L2HGA is a rare autosomal recessive disorder clinically characterized by mild psychomotor delay in the first years of life, followed by progressive cerebellar ataxia, dysarthria and moderate to severe mental retardation. Diagnosis is based on the presence of an excess of L-2-hydroxyglutaric acid in urine, blood and cerebrospinal fluid. -
Sequence similarities
Belongs to the L2HGDH family. -
Cellular localization
Mitochondrion. - Information by UniProt
-
Database links
- Entrez Gene: 79944 Human
- Entrez Gene: 100172827 Orangutan
- Omim: 609584 Human
- SwissProt: Q9H9P8 Human
- SwissProt: Q5R9N7 Orangutan
- Unigene: 256034 Human
-
Alternative names
- 2 hydroxyglutarate dehydrogenase antibody
- Alpha hydroxyglutarate oxidoreductase antibody
- Alpha ketoglutarate reductase antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-L2HGDH antibody (ab230194)Paraffin-embedded human testis tissue stained for L2HGDH using ab230194 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab230194 has not yet been referenced specifically in any publications.
