Overview

  • Product name

    Anti-L3MBTL4 antibody
  • Description

    Rabbit polyclonal to L3MBTL4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human L3MBTL4 aa 1-270.
    Sequence:

    MKQPNRKRKLNMDSKERLDQDGRLEQAEEEKKPKDSTTPLSHVPSAAAQG AWSWEWYLKEQKAVAAPVELFSKDQSFPEHENGFQIGMRLEGIDPRHPSV FCVLSVAEVCGYRLRLHFDGYLSCYDFWTNAGSPDIHPVGWCEKTKHELH IPKGYRKDKFVWMDYLKACKLQNAPKKLFRNRSPNGPMSKEFQVGMKLEA VDRKNPSLVCVATIADIVEDRLLVHFDNWDDSYDYWCDVNSPYVQPVGWC QENGRTLIAPQGYPNPENFSDKPRR


    Database link: Q8NA19

  • Positive control

    • IHC-P: Human testis and prostate cancer tissues. WB: Rat brain tissue lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235089 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 71 kDa.

Target

  • Relevance

    L3MBTL4 contains 3 MBT repeats and 1 SAM (sterile alpha motif) domain. The exact function of L3MBTL4 remains unknown.
  • Cellular localization

    Nucleus
  • Database links

  • Alternative names

    • 3bt-like 4 antibody
    • A730037L19Rik antibody
    • D930040M24Rik antibody
    • FLJ35936 antibody
    • H-l(3)mbt-like protein antibody
    • HsT1031 antibody
    • l(3)mbt like 4 (Drosophila) antibody
    • l(3)mbt like 4 antibody
    • l(3)mbt-like 4 (Drosophila) antibody
    • l(3)mbt-like 4 antibody
    • L(3)mbt-like 4 protein antibody
    • L3mbtl4 antibody
    • Lethal (3) malignant brain tumor-like 4 protein antibody
    • Lethal(3)malignant brain tumor-like protein 4 antibody
    see all

Images

  • Anti-L3MBTL4 antibody (ab235089) at 1/500 dilution + Rat brain tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 71 kDa

  • Paraffin-embedded human testis tissue stained for L3MBTL4 using ab235089 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate cancer tissue stained for L3MBTL4 using ab235089 at 1/100 dilution in immunohistochemical analysis.

References

ab235089 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235089.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up