Overview

  • Product name

    Anti-Lactate Dehydrogenase antibody
    See all Lactate Dehydrogenase primary antibodies
  • Description

    Goat polyclonal to Lactate Dehydrogenase
  • Host species

    Goat
  • Tested applications

    Suitable for: IP, WBmore details
  • Species reactivity

    Reacts with: Rabbit, Human
    Predicted to work with: Mammals
  • Immunogen

    Full length native protein (purified) corresponding to Rabbit Lactate Dehydrogenase aa 2-332. (Isolated from rabbit muscle).
    Sequence:

    AALKDQLIHNLLKEEHVPQNKITVVGVGAVGMACAISILMKDLADELALV DVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARQQ EGESRLNLVQRNVNIFKFIIPNVVKYSPHCKLLVVSNPVDILTYVAWKIS GFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWILGEHGDSSVPVW SGMNVAGVSLKTLHPELGTDADKEQWKQVHKQVVDSAYEVIKLKGYTTWA IGLSVADLAESIMKNLRRVHPISTMLKGLYGIKEDVFLSVPCVLGQNGIS DVVKVTLTSEEEAHLKKSADTLWGIQKELQF


    Database link: P13491

  • Positive control

    • Cytoplasmic and nuclear HeLa cell fractions.

Properties

Applications

Our Abpromise guarantee covers the use of ab191332 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP 1/100.
WB 1/1000 - 1/5000. Detects a band of approximately 36 kDa (predicted molecular weight: 37 kDa).

Target

  • Pathway

    Fermentation; pyruvate fermentation to lactate; (S)-lactate from pyruvate: step 1/1.
  • Involvement in disease

    Defects in LDHA are the cause of glycogen storage disease type 11 (GSD11) [MIM:612933]. A metabolic disorder that results in exertional myoglobinuria, pain, cramps and easy fatigue.
  • Sequence similarities

    Belongs to the LDH/MDH superfamily. LDH family.
  • Post-translational
    modifications

    ISGylated.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cell proliferation-inducing gene 19 protein antibody
    • GSD11 antibody
    • L lactate dehydrogenase B chain antibody
    • L-lactate dehydrogenase A chain antibody
    • Lactate dehydrogenase A antibody
    • Lactate dehydrogenase B antibody
    • Lactate dehydrogenase c variant 1 antibody
    • Lactate dehydrogenase c variant 3 antibody
    • Lactate dehydrogenase c variant 4 antibody
    • Lactate dehydrogenase C4 antibody
    • Lactate dehydrogenase H chain antibody
    • Lactate dehydrogenase M antibody
    • LDH A antibody
    • LDH B antibody
    • LDH H antibody
    • LDH heart subunit antibody
    • LDH M antibody
    • LDH muscle subunit antibody
    • LDH-A antibody
    • LDH-M antibody
    • LDH1 antibody
    • ldha antibody
    • LDHA_HUMAN antibody
    • LDHBD antibody
    • LDHM antibody
    • MS1111 antibody
    • PIG19 antibody
    • Proliferation inducing gene 19 antibody
    • Proliferation-inducing gene 19 antibody
    • Renal carcinoma antigen NY REN 46 antibody
    • Renal carcinoma antigen NY-REN-59 antibody
    • TRG 5 antibody
    • TRG5 antibody
    see all

Images

  • All lanes : Anti-Lactate Dehydrogenase antibody (ab191332) at 1/400 dilution

    Lanes 1-4 : HeLa cell extract cytoplasmic fraction
    Lanes 5-8 : HeLa cell extract nuclear fraction

    Lysates/proteins at 30 µg per lane.

    Secondary
    All lanes : IRDye800™ secondary antibody at 1/10000 dilution

    Predicted band size: 37 kDa
    Observed band size: 36 kDa
    why is the actual band size different from the predicted?

References

This product has been referenced in:

  • Hoshino A  et al. Cytosolic p53 inhibits Parkin-mediated mitophagy and promotes mitochondrial dysfunction in the mouse heart. Nat Commun 4:2308 (2013). Read more (PubMed: 23917356) »
  • Iguchi M  et al. Parkin-catalyzed ubiquitin-ester transfer is triggered by PINK1-dependent phosphorylation. J Biol Chem 288:22019-32 (2013). Read more (PubMed: 23754282) »
See all 16 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191332.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up