Overview

  • Product name

  • Description

    Rabbit polyclonal to LAG-3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human LAG-3 aa 29-450. Extracellular domain.
    Sequence:

    VPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGH PLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQ RGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGS LRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFL PQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRV GLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQA GTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQE RFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFT ELSSPGAQRSGRAPGALPAGHL


    Database link: P18627

  • Positive control

    • WB: Rat liver lysate; Jurkat and HepG2 whole cell lysates. IHC-P: Human tonsil tissue. ICC/IF: HepG2 cells.
  • General notes

    This product was previously labelled as Lymphocyte Activation Gene 3.

Properties

Applications

Our Abpromise guarantee covers the use of ab235907 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 57 kDa.
IHC-P 1/200 - 1/500.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Involved in lymphocyte activation. Binds to HLA class-II antigens.
  • Tissue specificity

    On cell surface of activated NK and T-lymphocytes.
  • Sequence similarities

    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD223 antibody
    • CD223 antigen antibody
    • FDC protein antibody
    • LAG-3 antibody
    • Lag3 antibody
    • LAG3_HUMAN antibody
    • Lymphocyte activating 3 antibody
    • Lymphocyte activation gene 3 antibody
    • Lymphocyte activation gene 3 protein antibody
    • Protein FDC antibody
    see all

Images

  • Paraffin-embedded human tonsil tissue stained for LAG-3 using ab235907 at 1/200 dilution in immunohistochemical analysis. 

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • All lanes : Anti-LAG-3 antibody (ab235907) at 1/500 dilution

    Lane 1 : Rat liver lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 57 kDa

  • Anti-LAG-3 antibody (ab235907) at 1/500 dilution + HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 57 kDa

  • 4% formaldehyde-fixed, 0.2% Triton X-100 permeabilized HepG2 (human liver hepatocellular carcinoma cell line) cells stained for LAG-3 (green) using ab235907 at 1/66 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab235907 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235907.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up