Overview

  • Product name

    Anti-LAMA3 antibody [CL3112]
    See all LAMA3 primary antibodies
  • Description

    Mouse monoclonal [CL3112] to LAMA3
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human LAMA3 aa 2001-2106.
    Sequence:

    LLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQ ANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQLM EKSQKEYE


    Database link: Q16787

  • Positive control

    • IHC-P: Human stomach, colon and oral mucosa tissue. WB: Human Lamin-332 recombinant protein.
  • General notes

     This product was previously labelled as Laminin subunit alpha-3, Laminin 5 alpha 3

     

Properties

Applications

Our Abpromise guarantee covers the use of ab242197 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 367 kDa.

Target

  • Function

    Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
    Laminin-5 is thought to be involved in (1) cell adhesion via integrin alpha-3/beta-1 in focal adhesion and integrin alpha-6/beta-4 in hemidesmosomes, (2) signal transduction via tyrosine phosphorylation of pp125-FAK and p80, (3) differentiation of keratinocytes.
  • Tissue specificity

    Skin; respiratory, urinary, and digestive epithelia and in other specialized tissues with prominent secretory or protective functions. Epithelial basement membrane, and epithelial cell tongue that migrates into a wound bed. A differential and focal expression of the subunit alpha-3 is observed in the CNS.
  • Involvement in disease

    Defects in LAMA3 are a cause of epidermolysis bullosa junctional Herlitz type (H-JEB) [MIM:226700]; also known as junctional epidermolysis bullosa Herlitz-Pearson type. JEB defines a group of blistering skin diseases characterized by tissue separation which occurs within the dermo-epidermal basement membrane. H-JEB is a severe, infantile and lethal form. Death occurs usually within the first six months of life. Occasionally, children survive to teens. H-JEB is marked by bullous lesions at birth and extensive denudation of skin and mucous membranes that may be hemorrhagic.
    Defects in LAMA3 are the cause of laryngoonychocutaneous syndrome (LOCS) [MIM:245660]. LOCS is an autosomal recessive epithelial disorder confined to the Punjabi Muslim population. The condition is characterized by cutaneous erosions, nail dystrophy and exuberant vascular granulation tissue in certain epithelia, especially conjunctiva and larynx.
  • Sequence similarities

    Contains 15 laminin EGF-like domains.
    Contains 5 laminin G-like domains.
    Contains 1 laminin IV type A domain.
    Contains 1 laminin N-terminal domain.
  • Domain

    The alpha-helical domains I and II are thought to interact with other laminin chains to form a coiled coil structure.
    Domain G is globular.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix > basement membrane. Major component.
  • Information by UniProt
  • Database links

  • Alternative names

    • E170 antibody
    • Epiligrin 170 kDa subunit antibody
    • Epiligrin subunit alpha antibody
    • Kalinin B1 chain antibody
    • Kalinin subunit alpha antibody
    • LAMA3 antibody
    • LAMA3_HUMAN antibody
    • LAMB3 antibody
    • LAMC2 antibody
    • Laminin gamma 2 antibody
    • Laminin 5 beta 3 antibody
    • Laminin 5 gamma 2 subunit antibody
    • Laminin beta 3 antibody
    • Laminin subunit alpha-3 antibody
    • Laminin subunit beta 3 antibody
    • Laminin subunit gamma 2 antibody
    • Laminin-5 subunit alpha antibody
    • Laminin-6 subunit alpha antibody
    • Laminin-7 subunit alpha antibody
    • Nicein subunit alpha antibody
    see all

Images

  • Paraffin-embedded human oral mucosa tissue stained for LAMA3 using ab242197 at 1 µg/mL in immunohistochemcial analysis.

  • Paraffin-embedded human colon tissue stained for LAMA3 using ab242197 at 1 µg/mL in immunohistochemcial analysis.

  • Paraffin-embedded human stomach tissue stained for LAMA3 using ab242197 at 1 µg/mL in immunohistochemcial analysis.

  • Negative control:

    Paraffin-embedded human lymph node tissue stained for LAMA3 using ab242197 at 1 µg/mL in immunohistochemcial analysis.

  • All lanes : Anti-LAMA3 antibody [CL3112] (ab242197) at 1 µg/ml

    Lane 1 : Purified human Lamin-332 recombinant protein
    Lane 2 : Purified human Lamin-421 recombinant protein
    Lane 3 : Purified human Lamin-511 recombinant protein
    Lane 4 : Purified human Lamin-121 recombinant protein
    Lane 5 : Purified human Lamin-221 recombinant protein

    Predicted band size: 367 kDa

References

ab242197 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab242197.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up