Overview

  • Product name

    Anti-LAMC2 antibody [CL2980]
    See all LAMC2 primary antibodies
  • Description

    Mouse monoclonal [CL2980] to LAMC2
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Horse
  • Immunogen

    Recombinant fragment corresponding to Human LAMC2 aa 1090-1175 (C terminal).
    Sequence:

    NAGVTIQDTLNTLDGLLHLMDQPLSVDEEGLVLLEQKLSRAKTQINSQLR PMMSELEERARQQRGHLHLLETSIDGLADVKNLEN


    Database link: Q13753

  • Epitope

    Binds to an epitope located within the peptide sequence IQDTLNTLDGLLHLM as determined by overlapping synthetic peptides.
  • Positive control

    • Purified Human recombinant protein LAMC2; A431 lysate; Human skin, stomach, prostate, cervix and colon tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    CL2980
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab210959 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/1000. Predicted molecular weight: 131 kDa.

Target

  • Function

    Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Ladsin exerts cell-scattering activity toward a wide variety of cells, including epithelial, endothelial, and fibroblastic cells.
  • Tissue specificity

    The large variant is expressed only in specific epithelial cells of embryonic and neonatal tissues. In 17-week old embryo the small variant is found in cerebral cortex, lung, and distal tubes of kidney, but not in epithelia except for distal tubuli.
  • Involvement in disease

    Defects in LAMC2 are a cause of epidermolysis bullosa junctional Herlitz type (H-JEB) [MIM:226700]; also known as junctional epidermolysis bullosa Herlitz-Pearson type. JEB defines a group of blistering skin diseases characterized by tissue separation which occurs within the dermo-epidermal basement membrane. H-JEB is a severe, infantile and lethal form. Death occurs usually within the first six months of life. Occasionally, children survive to teens. H-JEB is marked by bullous lesions at birth and extensive denudation of skin and mucous membranes that may be hemorrhagic.
  • Sequence similarities

    Contains 8 laminin EGF-like domains.
    Contains 1 laminin IV type A domain.
  • Domain

    The alpha-helical domains I and II are thought to interact with other laminin chains to form a coiled coil structure.
    Domain IV is globular.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix > basement membrane. Major component.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3918 antibody
    • B2T antibody
    • BM600 antibody
    • Cell-scattering factor 140 kDa subunit antibody
    • CSF 140 kDa subunit antibody
    • CSF antibody
    • EBR2 antibody
    • EBR2A antibody
    • Epiligrin subunit gamma antibody
    • Kalinin subunit gamma antibody
    • Kalinin/nicein/epiligrin 100 kDa subunit antibody
    • Ladsin 140 kDa subunit antibody
    • LAMB2T antibody
    • LAMC2 antibody
    • LAMC2_HUMAN antibody
    • Laminin 5 gamma 2 subunit antibody
    • Laminin B2t chain antibody
    • Laminin gamma 2 antibody
    • laminin gamma 2 chain antibody
    • Laminin subunit gamma-2 antibody
    • Laminin-5 subunit gamma antibody
    • LAMNB2 antibody
    • Large adhesive scatter factor 140 kDa subunit antibody
    • MGC138491 antibody
    • MGC141938 antibody
    • Nicein subunit gamma antibody
    • NICEIN-100KDA antibody
    see all

Images

  • Anti-LAMC2 antibody [CL2980] (ab210959) at 1/500 dilution + A431 lysate

    Predicted band size: 131 kDa

  • All lanes : Anti-LAMC2 antibody [CL2980] (ab210959) at 1/500 dilution

    Lane 1 : Purified Human recombinant protein LAMC2
    Lane 2 : Purified Human recombinant protein Laminin-421
    Lane 3 : Purified Human recombinant protein Laminin-511
    Lane 4 : Purified Human recombinant protein Laminin-121
    Lane 5 : Purified Human recombinant protein Laminin-221

    Predicted band size: 131 kDa

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human colon tissue labeling LAMC2 with ab210959 at 1/500 dilution.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human cervix tissue labeling LAMC2 with ab210959 at 1/500 dilution.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human prostate tissue labeling LAMC2 with ab210959 at 1/500 dilution.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human stomach tissue labeling LAMC2 with ab210959 at 1/500 dilution.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human skin tissue labeling LAMC2 with ab210959 at 1/500 dilution.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human lymph node tissue labeling LAMC2 with ab210959 at 1/500 dilution (negative control).

References

This product has been referenced in:

  • Pei YF  et al. Silencing of LAMC2 Reverses Epithelial-Mesenchymal Transition and Inhibits Angiogenesis in Cholangiocarcinoma via Inactivation of the Epidermal Growth Factor Receptor Signaling Pathway. Am J Pathol 189:1637-1653 (2019). Read more (PubMed: 31345467) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab210959.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up