Overview

  • Product name

  • Description

    Rabbit polyclonal to Lamin B1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Lamin B1 aa 52-233. (Expressed in E.coli).
    Sequence:

    SLETENSALQLQVTEREEVRGRELTGLKALYETELADARRALDDTARERA KLQIELGKCKAEHDQLLLNYAKKESDLNGAQIKLREYEAALNSKDAALAT ALGDKKSLEGDLEDLKDQIAQLEASLAAAKKQLADETLLKVDLENRCQSL TEDLEFRKSMYEEEINETRRKHETRLVEVDSG


    Database link: P20700

  • Positive control

    • IHC-P: Human brain tissue. WB: Recombinant human Lamin B1 protein; HeLa cell lysate; Human lung lysate, Pig brain and kidney lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab231282 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 66 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Lamins are components of the nuclear lamina, a fibrous layer on the nucleoplasmic side of the inner nuclear membrane, which is thought to provide a framework for the nuclear envelope and may also interact with chromatin.
  • Involvement in disease

    Defects in LMNB1 are the cause of leukodystrophy demyelinating autosomal dominant adult-onset (ADLD) [MIM:169500]. ADLD is a slowly progressive and fatal demyelinating leukodystrophy, presenting in the fourth or fifth decade of life. Clinically characterized by early autonomic abnormalities, pyramidal and cerebellar dysfunction, and symmetric demyelination of the CNS. It differs from multiple sclerosis and other demyelinating disorders in that neuropathology shows preservation of oligodendroglia in the presence of subtotal demyelination and lack of astrogliosis.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Post-translational
    modifications

    B-type lamins undergo a series of modifications, such as farnesylation and phosphorylation. Increased phosphorylation of the lamins occurs before envelope disintegration and probably plays a role in regulating lamin associations.
  • Cellular localization

    Nucleus inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ADLD antibody
    • lamin B1 antibody
    • Lamin-B1 antibody
    • LMN antibody
    • LMN2 antibody
    • LMNB antibody
    • Lmnb1 antibody
    • LMNB1_HUMAN antibody
    • MGC111419 antibody
    • OTTHUMP00000159218 antibody
    see all

Images

  • All lanes : Anti-Lamin B1 antibody (ab231282) at 2 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : Human lung lysate
    Lane 3 : Pig brain lysate
    Lane 4 : Pig kidney lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 66 kDa

  • Anti-Lamin B1 antibody (ab231282) at 2 µg/ml + Recombinant human Lamin B1 protein.

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 66 kDa

  • Paraffin-embedded human brain tissue stained for Lamin B1 using ab231282 at 20 μg/ml in immunohistochemical analysis. DAb staining.

References

ab231282 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231282.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up