Overview

  • Product name

  • Description

    Rabbit polyclonal to Lamin B2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Mouse Lamin B2 aa 1498-1716. Expressed in E.coli.
    Sequence:

    KANASRGQVEQANQELRELIQNVKDFLSQEGADPDSIEMVATRVLDISIP ASPEQIQRLASEIAERVRSLADVDTILAHTMGDVRRAEQLLQDAHRARSR AEGERQKAETVQAALEEAQRAQGAAQGAIWGAVVDTQNTEQTLQRVQERM AGAEKSLNSAGERARQLDALLEALKLKRAGNSLAASTAEETAGSAQSRAR EAEKQLREQVGDQYQTVRA


    Database link: Q61292

  • Positive control

    • WB: Recombinant mouse Lamin B2 and mouse small intestine tissue lysate. IHC-P: Mouse colon, cerebrum, uterus, small intestine, heart and oviduct tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233530 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 197 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Lamins are components of the nuclear lamina, a fibrous layer on the nucleoplasmic side of the inner nuclear membrane, which is thought to provide a framework for the nuclear envelope and may also interact with chromatin.
  • Involvement in disease

    Defects in LMNB2 are a cause of partial acquired lipodystrophy (APLD) [MIM:608709]. A rare childhood disease characterized by loss of subcutaneous fat from the face and trunk. Fat deposition on the pelvic girdle and lower limbs is normal or excessive. Most frequently, onset between 5 and 15 years of age. Most affected subjects are females and some show no other abnormality, but many develop glomerulonephritis, diabetes mellitus, hyperlipidemia, and complement deficiency. Mental retardation in some cases. APLD is a sporadic disorder of unknown etiology.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Post-translational
    modifications

    B-type lamins undergo a series of modifications, such as farnesylation and phosphorylation. Increased phosphorylation of the lamins occurs before envelope disintegration and probably plays a role in regulating lamin associations.
  • Cellular localization

    Nucleus inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • LAMB 2 antibody
    • LAMB2 antibody
    • Lamin-B2 antibody
    • LMN 2 antibody
    • LMN B2 antibody
    • LMN2 antibody
    • LMNB 2 antibody
    • LMNB2 antibody
    • LMNB2_HUMAN antibody
    • MGC2721 antibody
    • RGD1563803 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse colon tissue stained for Lamin B2 using ab233530 at 20μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse cerebrum tissue stained for Lamin B2 using ab233530 at 20μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse uterus tissue stained for Lamin B2 using ab233530 at 20μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse small intestine tissue stained for Lamin B2 using ab233530 at 20μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse heart tissue stained for Lamin B2 using ab233530 at 20μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse oviduct tissue stained for Lamin B2 using ab233530 at 20μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Lamin B2 antibody (ab233530) at 2 µg/ml + Recombinant mouse Lamin B2

    Developed using the ECL technique.

    Predicted band size: 197 kDa

  • Anti-Lamin B2 antibody (ab233530) at 2 µg/ml + Mouse small intestine tissue lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit Ab at 1/1000 dilution

    Developed using the ECL technique.

    Predicted band size: 197 kDa

References

ab233530 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233530.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up