Overview

  • Product name

    Anti-Laminin 2 alpha antibody [CL3450]
    See all Laminin 2 alpha primary antibodies
  • Description

    Mouse monoclonal [CL3450] to Laminin 2 alpha
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human Laminin 2 alpha aa 2111-2242.
    Sequence:

    DKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKP EIKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDV GSGVGRVEYPDLTIDDSYWYRIVASRTGRNGT


    Database link: P24043

  • Epitope

    Binds to an epitope located within the peptide sequence DKLKPIKELEDNLKK as determined by overlapping synthetic peptides.
  • Positive control

    • IHC-P: Human heart, placenta and cerebral cortex tissues; Rat heart muscle and stomach tissues; Mouse heart muscle tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab236762 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 344 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
  • Tissue specificity

    Placenta, striated muscle, peripheral nerve, cardiac muscle, pancreas, lung, spleen, kidney, adrenal gland, skin, testis, meninges, choroid plexus, and some other regions of the brain; not in liver, thymus and bone.
  • Involvement in disease

    Defects in LAMA2 are the cause of merosin-deficient congenital muscular dystrophy type 1A (MDC1A) [MIM:607855]. MDC1A is characterized by difficulty walking, hypotonia, proximal weakness, hyporeflexia, and white matter hypodensity on MRI.
  • Sequence similarities

    Contains 17 laminin EGF-like domains.
    Contains 5 laminin G-like domains.
    Contains 2 laminin IV type A domains.
    Contains 1 laminin N-terminal domain.
  • Domain

    The alpha-helical domains I and II are thought to interact with other laminin chains to form a coiled coil structure.
    Domains VI, IV and G are globular.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix > basement membrane. Major component.
  • Information by UniProt
  • Database links

  • Alternative names

    • LAMA 2 antibody
    • LAMA2 antibody
    • LAMA2_HUMAN antibody
    • Laminin alpha 2 (merosin congenital muscular dystrophy) antibody
    • Laminin alpha 2 antibody
    • Laminin alpha 2 chain antibody
    • Laminin alpha 2 subunit antibody
    • Laminin M antibody
    • Laminin M chain antibody
    • Laminin subunit alpha-2 antibody
    • Laminin-12 subunit alpha antibody
    • Laminin-2 subunit alpha antibody
    • Laminin-4 subunit alpha antibody
    • LAMM antibody
    • Merosin heavy chain antibody
    see all

Images

  • All lanes : Anti-Laminin 2 alpha antibody [CL3450] (ab236762) at 1 µg/ml

    Lane 1 : Purified human recombinant Laminin-211
    Lane 2 : Purified human recombinant Laminin-221
    Lane 3 : Purified human recombinant Laminin-332
    Lane 4 : Purified human recombinant Laminin-421
    Lane 5 : Purified human recombinant Laminin-511
    Lane 6 : Purified human recombinant Laminin-121

    Predicted band size: 344 kDa

  • Paraffin-embedded human heart tissue stained for Laminin 2 alpha using ab236762 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human placenta tissue stained for Laminin 2 alpha using ab236762 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human cerebral cortex tissue stained for Laminin 2 alpha using ab236762 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded rat heart tissue stained for Laminin 2 alpha using ab236762 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded rat stomach tissue stained for Laminin 2 alpha using ab236762 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded mouse heart tissue stained for Laminin 2 alpha using ab236762 at 1/200 dilution in immunohistochemical analysis.

References

ab236762 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236762.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up