Overview

  • Product name

    Anti-Laminin alpha 4/LAMA4 antibody
    See all Laminin alpha 4/LAMA4 primary antibodies
  • Description

    Sheep polyclonal to Laminin alpha 4/LAMA4
  • Host species

    Sheep
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human Laminin alpha 4/LAMA4 aa 826-1816. (Derived from Chinese hamster ovary cell line CHO).
    Sequence:

    RSVASKIQVSMMFDGQSAVEVHSRTSMDDLKAFTSLSLYMKPPVKRPELT ETADQFILYLGSKNAKKEYMGLAIKNDNLVYVYNLGTKDVEIPLDSKPVS SWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKFIKKGEFSGDDSLLDL DPEDTVFYVGGVPSNFKLPTSLNLPGFVGCLELATLNNDVISLYNFKHIY NMDPSTSVPCARDKLAFTQSRAASYFFDGSGYAVVRDITRRGKFGQVTRF DIEVRTPADNGLILLMVNGSMFFRLEMRNGYLHVFYDFGFSGGPVHLEDT LKKAQINDAKYHEISIIYHNDKKMILVVDRRHVKSMDNEKMKIPFTDIYI GGAPPEILQSRALRAHLPLDINFRGCMKGFQFQKKDFNLLEQTETLGVGY GCPEDSLISRRAYFNGQSFIASIQKISFFDGFEGGFNFRTLQPNGLLFYY ASGSDVFSISLDNGTVIMDVKGIKVQSVDKQYNDGLSHFVISSVSPTRYE LIVDKSRVGSKNPTKGKIEQTQASEKKFYFGGSPISAQYANFTGCISNAY FTRVDRDVEVEDFQRYTEKVHTSLYECPIESSPLFLLHKKGKNLSKPKAS QNKKGGKSKDAPSWDPVALKLPERNTPRNSHCHLSNSPRAIEHAYQYGGT ANSRQEFEHLKGDFGAKSQFSIRLRTRSSHGMIFYVSDQEENDFMTLFLA HGRLVYMFNVGHKKLKIRSQEKYNDGLWHDVIFIRERSSGRLVIDGLRVL EESLPPTEATWKIKGPIYLGGVAPGKAVKNVQINSIYSFSGCLSNLQLNG ASITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFE VRPRSSSGTLVHGHSVNGEYLNVHMKNGQVIVKVNNGIRDFSTSVTPKQS LCDGRWHRITVIRDSNVVQLDVDSEVNHVVGPLNPKPIDHREPVFVGGVP ESLLTPRLAPSKPFTGCIRHFVIDGHPVSFSKAALVSGAVS


    Database link: Q16363

  • Positive control

    • Human placenta tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab214935 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Detects a band of approximately 210 kDa (predicted molecular weight: 202 kDa).

Target

  • Function

    Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
  • Tissue specificity

    In adult, strong expression in heart, lung, ovary small and large intestines, placenta, liver; weak or no expression in skeletal muscle, kidney, pancreas, testis, prostate, brain. High expression in fetal lung and kidney. Expression in fetal and newborn tissues is observed in certain mesenchymal cells in tissues such as smooth muscle and dermis.
  • Involvement in disease

    Cardiomyopathy, dilated 1JJ
  • Sequence similarities

    Contains 4 laminin EGF-like domains.
    Contains 5 laminin G-like domains.
  • Domain

    The alpha-helical domains I and II are thought to interact with other laminin chains to form a coiled coil structure.
    Domain G is globular.
  • Cellular localization

    Secreted, extracellular space, extracellular matrix, basement membrane. Major component.
  • Information by UniProt
  • Database links

  • Alternative names

    • CMD1JJ antibody
    • DKFZp686D23145 antibody
    • LAMA3 antibody
    • LAMA3, formerly antibody
    • LAMA4 1 antibody
    • LAMA4 antibody
    • LAMA4*-1 antibody
    • LAMA4_HUMAN antibody
    • Laminin alpha 4 antibody
    • Laminin alpha 4 chain antibody
    • Laminin subunit alpha 4 precursor antibody
    • Laminin subunit alpha-4 antibody
    • Laminin-14 subunit alpha antibody
    • Laminin-8 subunit alpha antibody
    • Laminin-9 subunit alpha antibody
    see all

Images

References

ab214935 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214935.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up