Overview

  • Product name

    Anti-Laminin alpha 4/LAMA4 antibody [CL3185]
    See all Laminin alpha 4/LAMA4 primary antibodies
  • Description

    Mouse monoclonal [CL3185] to Laminin alpha 4/LAMA4
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human Laminin alpha 4/LAMA4 aa 670-809.
    Sequence:

    ENLLNQARELQAKAESSSDEAVADTSRRVGGALARKSALKTRLSDAVKQL QAAERGDAQQRLGQSRLITEEANRTTMEVQQATAPMANNLTNWSQNLQHF DSSAYNTAVNSARDAVRNLTEVVPQLLDQLRTVEQKRPAS


    Database link: Q16363

  • Epitope

    Binds to an epitope located within the peptide sequence GALARKSALKTRLSD as determined by overlapping synthetic peptides.
  • Positive control

    • WB: Recombinant human Laminin-411 and Laminin-421 proteins. IHC-P: Human rectum, placenta and prostate tissue; mouseheart muscle, stomach and epididymis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab242359 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 203 kDa.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
  • Tissue specificity

    In adult, strong expression in heart, lung, ovary small and large intestines, placenta, liver; weak or no expression in skeletal muscle, kidney, pancreas, testis, prostate, brain. High expression in fetal lung and kidney. Expression in fetal and newborn tissues is observed in certain mesenchymal cells in tissues such as smooth muscle and dermis.
  • Involvement in disease

    Cardiomyopathy, dilated 1JJ
  • Sequence similarities

    Contains 4 laminin EGF-like domains.
    Contains 5 laminin G-like domains.
  • Domain

    The alpha-helical domains I and II are thought to interact with other laminin chains to form a coiled coil structure.
    Domain G is globular.
  • Cellular localization

    Secreted, extracellular space, extracellular matrix, basement membrane. Major component.
  • Information by UniProt
  • Database links

  • Alternative names

    • CMD1JJ antibody
    • DKFZp686D23145 antibody
    • LAMA3 antibody
    • LAMA3, formerly antibody
    • LAMA4 1 antibody
    • LAMA4 antibody
    • LAMA4*-1 antibody
    • LAMA4_HUMAN antibody
    • Laminin alpha 4 antibody
    • Laminin alpha 4 chain antibody
    • Laminin subunit alpha 4 precursor antibody
    • Laminin subunit alpha-4 antibody
    • Laminin-14 subunit alpha antibody
    • Laminin-8 subunit alpha antibody
    • Laminin-9 subunit alpha antibody
    see all

Images

  • All lanes : Anti-Laminin alpha 4/LAMA4 antibody [CL3185] (ab242359) at 1 µg/ml

    Lane 1 : Recombinant humanan Laminin-411 protein
    Lane 2 : Recombinant human Laminin-421 protein
    Lane 3 : Recombinant human Laminin-511 protein
    Lane 4 : Recombinant human Laminin-121 protein
    Lane 5 : Recombinant human Laminin-221 protein
    Lane 6 : Recombinant human Laminin-332 protein

    Predicted band size: 203 kDa

  • Paraffin-embedded human rectum tissue stained for Laminin alpha 4/LAMA4 with ab242359 at 1/500 dilution in immunohistochemical analysis.

     

  • Paraffin-embedded human placenta tissue stained for Laminin alpha 4/LAMA4 with ab242359 at 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate tissue stained for Laminin alpha 4/LAMA4 with ab242359 at 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded mouse heart muscle tissue stained for Laminin alpha 4/LAMA4 with ab242359 at 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded mouse stomach tissue stained for Laminin alpha 4/LAMA4 with ab242359 at 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded mouse epididymis tissue stained for Laminin alpha 4/LAMA4 with ab242359 at 1/500 dilution in immunohistochemical analysis.

  • Negative control:

    Paraffin-embedded human lymph node tissue stained for Laminin alpha 4/LAMA4 with ab242359 at 1/500 dilution in immunohistochemical analysis.

References

ab242359 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab242359.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up