Overview

  • Product name

    Anti-Laminin alpha 5/LAMA5 antibody
    See all Laminin alpha 5/LAMA5 primary antibodies
  • Description

    Rabbit polyclonal to Laminin alpha 5/LAMA5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Laminin alpha 5/LAMA5 aa 3463-3562.
    Sequence:

    QPHTLFVGGLPASSHSSKLPVTVGFSGCVKRLRLHGRPLGAPTRMAGVTP CILGPLEAGLFFPGSGGVITLDLPGATLPDVGLELEVRPLAVTGLIFHLG


    Database link: O15230

  • Positive control

    • ICC/IF - Caco2 cells
  • General notes

     This product was previously labelled as Laminin alpha 5

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220399 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
  • Tissue specificity

    Expressed in heart, lung, kidney, skeletal muscle, pancreas, retina and placenta. Little or no expression in brain and liver.
  • Sequence similarities

    Contains 22 laminin EGF-like domains.
    Contains 5 laminin G-like domains.
    Contains 1 laminin IV type A domain.
    Contains 1 laminin N-terminal domain.
  • Domain

    Domain G is globular and is part of the major cell-binding site located in the long arm of the laminin heterotrimer.
  • Cellular localization

    Secreted, extracellular space, extracellular matrix, basement membrane. Major component.
  • Information by UniProt
  • Database links

  • Alternative names

    • KIAA0533 antibody
    • KIAA1907 antibody
    • LAMA5 antibody
    • LAMA5_HUMAN antibody
    • Laminin alpha 5 chain antibody
    • Laminin subunit alpha 5 antibody
    • Laminin subunit alpha-5 antibody
    • Laminin, alpha 5 antibody
    • Laminin-10 subunit alpha antibody
    • Laminin-11 subunit alpha antibody
    • Laminin-15 subunit alpha antibody
    • RP11-157P1.6 antibody
    see all

Images

  • Immunofluorescent analysis of PFA fixed, Triton X-100 permeabilized Caco2 cells labeling Laminin alpha 5/LAMA5 with ab220399 at 4 µg/ml (green).

References

ab220399 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Frozen sections)
Sample
Human Tissue sections (Skeletal muscle (Vastus Lateralis))
Permeabilization
No
Specification
Skeletal muscle (Vastus Lateralis)
Fixative
No fixative

Abcam user community

Verified customer

Submitted Jan 15 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up